DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and Zdhhc19

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001034348.1 Gene:Zdhhc19 / 288045 RGDID:1309014 Length:359 Species:Rattus norvegicus


Alignment Length:211 Identity:51/211 - (24%)
Similarity:82/211 - (38%) Gaps:37/211 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 VRYCKTCWIIKPDRAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFYAEVYCFYLFCVM 188
            :.:|..|...:|.|.:||..|::||...||||.|:.||:...||:.|:|.:.:   .|.|...::
  Rat   114 LEWCPKCLFHRPPRTYHCPWCNICVEDFDHHCKWVNNCIGHRNFRLFVLLILF---LCLYSGALL 175

  Fly   189 VYDLYLICGFEVTALKNQHSWNILQYLVCILFNIFTVIMYTVSLLNVSRNRTTMESAYATYFLLG 253
            |..|..:............:..||..:....|.|...::..:..|:|||...:.||....:    
  Rat   176 VTCLMFLIHTSHLPFSLDKAMAILVAVPAAGFLIPLFLLMLIQALSVSRAERSYESKCRDH---- 236

  Fly   254 GKNNNGFNLGYFVNFRDLYGDKWYLWPFPIFSSRGDGFSFPLAHDRLKEVRTGNQKKDNQPTRTQ 318
             :..|.|:.|:..|        |||           ....||..:.:.||..     ..:|..|:
  Rat   237 -EEYNPFDQGFAKN--------WYL-----------TMCAPLGPNYMSEVVC-----LQRPVGTE 276

  Fly   319 MYKENMNRILGIHQPP 334
            ..:|...     |.||
  Rat   277 RIQEKTK-----HPPP 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 32/117 (27%)
Zdhhc19NP_001034348.1 zf-DHHC 112..230 CDD:279823 32/118 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.