DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and Zdhhc8

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001365948.1 Gene:Zdhhc8 / 27801 MGIID:1338012 Length:775 Species:Mus musculus


Alignment Length:271 Identity:70/271 - (25%)
Similarity:109/271 - (40%) Gaps:54/271 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PIGEGHRRVPCCAVRWLPALIILGFLVWSYHVFVYQIC---IKKVSDYLTIGLLLFFYHLLLFMF 64
            |...|.|..|   .:::|.......||.|..:|....|   .:.||..:.:      |:.:||:|
Mouse     2 PRSPGTRLKP---AKYIPVATAAALLVGSSTLFFVFTCPWLTRAVSPAIPV------YNGILFLF 57

  Fly    65 LWTWFRCIFVAPVRIPDQWKISPEDVDK-------LKRNDGIEGASRVLNYAARNLPIATCTIDG 122
            :...|.   :|....|..:..:.||.||       |.:|..:.|                  |..
Mouse    58 VLANFS---MATFMDPGVFPRADEDEDKEDDFRAPLYKNVDVRG------------------IQV 101

  Fly   123 LVRYCKTCWIIKPDRAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFYAEVYCFYLFCV 187
            .:::|.||...:|.|..||..|..||...||||||:.||:...|::||.|||.....   ::..|
Mouse   102 RMKWCATCHFYRPPRCSHCSVCDNCVEDFDHHCPWVNNCIGRRNYRYFFLFLLSLSA---HMVGV 163

  Fly   188 MVYDLYLICGFEVTALKNQHSWNILQYLVCI--LFNIFTVIMYTVSLLNVSRNRTTMESAYATYF 250
            :.:.|..:.... ..|...|: .|...::|:  ||.|..:.:....::.|:|.|||.|.      
Mouse   164 VAFGLLYVLNHS-EGLGAAHT-TITMAVMCVAGLFFIPVIGLTGFHVVLVTRGRTTNEQ------ 220

  Fly   251 LLGGKNNNGFN 261
             :.||...|.|
Mouse   221 -VTGKFRGGVN 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 38/119 (32%)
Zdhhc8NP_001365948.1 DHHC 99..224 CDD:396215 40/136 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.