Sequence 1: | NP_611197.1 | Gene: | CG17287 / 36939 | FlyBaseID: | FBgn0034202 | Length: | 338 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_997223.1 | Gene: | ZDHHC24 / 254359 | HGNCID: | 27387 | Length: | 284 | Species: | Homo sapiens |
Alignment Length: | 211 | Identity: | 50/211 - (23%) |
---|---|---|---|
Similarity: | 84/211 - (39%) | Gaps: | 65/211 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 126 YCKTCWIIKPDRAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFYAEVYCFYLFCVMVY 190
Fly 191 DLYLICGFEVTALKNQHS-----------W--------NILQY-------------LVC---ILF 220
Fly 221 NIFTVIMYTVSLLNVSRNRTTMESAYATYFLLGGKNNNGFNLGYFVNFRDLYGDKW---YLWPFP 282
Fly 283 IFSSRGDGFSFPLAHD 298 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17287 | NP_611197.1 | zf-DHHC | 125..243 | CDD:279823 | 34/151 (23%) |
ZDHHC24 | NP_997223.1 | zf-DHHC | 95..234 | CDD:279823 | 36/165 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |