DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and ZDHHC24

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_997223.1 Gene:ZDHHC24 / 254359 HGNCID:27387 Length:284 Species:Homo sapiens


Alignment Length:211 Identity:50/211 - (23%)
Similarity:84/211 - (39%) Gaps:65/211 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 YCKTCWIIKPDRAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFYAEVYCFYLFCVMVY 190
            ||..|....|.|:.||..|.:|:|:.||||..:..||.|.|::.|:..|.:|        ..::.
Human    95 YCYQCQSQVPPRSGHCSACRVCILRRDHHCRLLGRCVGFGNYRPFLCLLLHA--------AGVLL 151

  Fly   191 DLYLICGFEVTALKNQHS-----------W--------NILQY-------------LVC---ILF 220
            .:.::.|..::||...|:           |        ::.|:             |:|   :||
Human   152 HVSVLLGPALSALLRAHTPLHMAALLLLPWLMLLTGRVSLAQFALAFVTDTCVAGALLCGAGLLF 216

  Fly   221 NIFTVIMYTVSLLNVSRNRTTMESAYATYFLLGGKNNNGFNLGYFVNFRDLYGDKW---YLWPFP 282
            :...::          |.:||.|.|         :..:.::||...|.:...|.:|   :||||.
Human   217 HGMLLL----------RGQTTWEWA---------RGQHSYDLGPCHNLQAALGPRWALVWLWPFL 262

  Fly   283 IFSSRGDGFSFPLAHD 298
            .....|||.:|....|
Human   263 ASPLPGDGITFQTTAD 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 34/151 (23%)
ZDHHC24NP_997223.1 zf-DHHC 95..234 CDD:279823 36/165 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.