DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and erf2

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_595766.1 Gene:erf2 / 2541058 PomBaseID:SPBC3H7.09 Length:350 Species:Schizosaccharomyces pombe


Alignment Length:302 Identity:67/302 - (22%)
Similarity:98/302 - (32%) Gaps:117/302 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VYQIC--IKKVSDYLTIGLLLFFYHL---LLFMF--LWTW----------------------FRC 71
            :|..|  ::..|.|....:.||...|   |.|:|  .|.|                      |:|
pombe    71 IYLCCGRLQMSSQYKAFLISLFALILPGVLFFIFSAFWLWHHVSPAVPITFAYLYALAVVSMFKC 135

  Fly    72 IFVAPVRIP-----------DQWKISPEDVDKLKRNDGIEGASRVLNYAARNLPIATCTIDGLVR 125
            ....|..:|           ..|.:.|||             .:||..:.|:..:...|:     
pombe   136 STADPGILPRNAYSLTYNPAHPWSVIPED-------------RKVLVGSTRSDSVFVNTV----- 182

  Fly   126 YCKTCWIIKPDRAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFL--------------FY 176
            ||.||.:.:|.||.||..|..||..:||||.|:..|:...|::|:.:||              ||
pombe   183 YCHTCHLYRPPRASHCHLCDNCVEYLDHHCIWLNTCIGRRNYRYYFIFLLSVVLSALYLTGLGFY 247

  Fly   177 AEVYCFY-----------------------------------LFCVMVYDLYLIC----GFEVTA 202
            ..:..|:                                   |||   |..|||.    ..|...
pombe   248 TSIGSFHESTDTNFAAHLRRPWAGVSFFLGIYGALGAILPGILFC---YQCYLISVGQNVHEYLR 309

  Fly   203 LKNQHSWNILQYLVCILFNIFTVIMYTVSLLNVSRNRTTMES 244
            .|:..:.::..:...|..|...|:...   .|||..|.|.:|
pombe   310 AKSTETEDVHPFHDSIWLNFLVVLCRP---KNVSYVRPTRKS 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 42/170 (25%)
erf2NP_595766.1 COG5273 57..350 CDD:227598 67/302 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.