DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and swf1

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_596556.1 Gene:swf1 / 2539719 PomBaseID:SPBC13G1.07 Length:356 Species:Schizosaccharomyces pombe


Alignment Length:338 Identity:75/338 - (22%)
Similarity:117/338 - (34%) Gaps:132/338 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VFVYQICIKKVSDYLTIGLLLFFYH---LLLFMFLWTW----------FRCIFVAPVRIPDQWKI 85
            ||:|...|       |||:..||.:   |.....:..|          :..:::|.       |.
pombe    81 VFLYLALI-------TIGIASFFIYGSSLTQKFSIIDWISVLTSVLLPYISLYIAA-------KS 131

  Fly    86 SPEDVDKLKRNDGIEGASRVLNYAARNLPIATCTIDGLVRY---CKTCWIIKPDRAHHCRTCHMC 147
            :|..:| ||.          .|.|:|..|     .|..:.:   |.||...||.|:.|||.|::|
pombe   132 NPGKID-LKN----------WNEASRRFP-----YDYKIFFPNKCSTCKFEKPARSKHCRLCNIC 180

  Fly   148 VLKMDHHCPWIVNCVHFHNFKYFILFLFYAEVYCFYLFCV--MVYDLYLICGFEVTALKNQHS-- 208
            |.|.||||.||.|||..:|.:||.||          |.|.  :::...|..|:...||::...  
pombe   181 VEKFDHHCIWINNCVGLNNARYFFLF----------LLCTIQLLFHSILRLGYHFNALRDMRQYP 235

  Fly   209 ------WNILQ--------YLVCILFNIFTVIMYTVSLLNVSRNRTTMESAYATYFLLGGKNNNG 259
                  |..::        :|:.::.::..:.:.......|....||.||               
pombe   236 SFLRSWWFAIKSEGELGSVFLISLICSVLVLCLLGYEFFLVYAGYTTNES--------------- 285

  Fly   260 FNLGYFVNFRDLYGDKWYLWPFPIFSSRGDGFSFPLAHDRLKEVRTGNQKKDNQPTRTQMYKENM 324
                          :||                ..|||      ...|:|       ..||.||.
pombe   286 --------------EKW----------------SDLAH------LVKNRK-------VYMYYENG 307

  Fly   325 NRILGIHQPPFNE 337
            :::|.:.:...|:
pombe   308 SQLLALDKDASND 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 38/138 (28%)
swf1NP_596556.1 COG5273 47..356 CDD:227598 75/338 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.