DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and Zdhhc19

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_955013.1 Gene:Zdhhc19 / 245308 MGIID:2682948 Length:347 Species:Mus musculus


Alignment Length:354 Identity:80/354 - (22%)
Similarity:119/354 - (33%) Gaps:111/354 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RRVPCCAVRWLPALIILGFLVWSYHVFVYQICIKKVSDYLTIGLLLFFYHLLLFMFLWTW----- 68
            :::|...:.|.|:.:...|.|                      .||.|...|.|.|...|     
Mouse    15 QQLPSIPLSWFPSSVFAAFNV----------------------TLLLFLSGLFFGFPCRWLVQNG 57

  Fly    69 -----------FRCIFVAPVRIPDQWKISPEDVDKLKRNDGIEGASRV----LNYAARNLPIATC 118
                       |...|.:.|      .::..|...|.|....|....|    :|..|..|     
Mouse    58 EWAFPAITGPLFILTFFSLV------SLNFSDPGILHRGSTKEDPMTVHVVRVNQRAFRL----- 111

  Fly   119 TIDGLVRYCKTCWIIKPDRAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFYAEVYCFY 183
                  .:|..|...:|.|.:||..|::||...||||.|:.||:...||:.|:|.:.   ..|.|
Mouse   112 ------EWCPKCLFHRPPRTYHCPWCNICVEDFDHHCKWVNNCIGHRNFRLFMLLVL---SLCLY 167

  Fly   184 LFCVMVYDLYLICGFEVTALKNQHSWNILQYLVCIL-------FNIFTVIMYTVSLLNVSRNRTT 241
            ...::|..|..:       .:.:|....|...:.||       |.|...::..:..|:|||..::
Mouse   168 SGALLVTCLTFL-------FRTRHLPFSLDKGMAILVAVPAAGFLIPLFLLLLIQALSVSRAESS 225

  Fly   242 MESA---YATYFLLGGKNNNGFNLGYFVNFRDLYGDKWYLWPF----PIFSS------RGDGFSF 293
            .||.   :..|        |.|:.|:..|        |||..|    |.:.|      |..|.::
Mouse   226 YESKCRYHPEY--------NPFDQGFAKN--------WYLAMFAPLGPNYMSEVVCLQRPVGTAW 274

  Fly   294 ------PLAHDRLKEVRTGNQKKDNQPTR 316
                  |....|.|..|.|.....:||.|
Mouse   275 IQEKTKPSPPRRPKHCRPGPPGPQHQPRR 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 34/124 (27%)
Zdhhc19NP_955013.1 DHHC 109..>181 CDD:366691 25/92 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..347 8/29 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.