Sequence 1: | NP_611197.1 | Gene: | CG17287 / 36939 | FlyBaseID: | FBgn0034202 | Length: | 338 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_082307.1 | Gene: | Zdhhc13 / 243983 | MGIID: | 1919227 | Length: | 622 | Species: | Mus musculus |
Alignment Length: | 307 | Identity: | 65/307 - (21%) |
---|---|---|---|
Similarity: | 97/307 - (31%) | Gaps: | 116/307 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 WLPALIILGFLVW-----------------SYHVFVYQICIKKVSDYLTIGLLLFFYHLLLFMFL 65
Fly 66 WTWFRCIFVAPVRIPDQWKISPEDVDKLKRNDGIEGASRVLNYAARNLPIATCTIDGLV---RYC 127
Fly 128 KTCWIIKPDRAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFYAEVYCFYLFCVMVYDL 192
Fly 193 YLI----CGFEVTALKNQHSWNILQYLVC---------------------ILFNIFTVIMY---- 228
Fly 229 ---TVSLLNVSRNRTTMESAYATYFLLGGKNNNGFNLGYFVNFRDLY 272 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17287 | NP_611197.1 | zf-DHHC | 125..243 | CDD:279823 | 37/149 (25%) |
Zdhhc13 | NP_082307.1 | ANK 1. /evidence=ECO:0000250|UniProtKB:Q8IUH5 | 43..78 | ||
ANK | 79..192 | CDD:238125 | |||
ANK repeat | 81..112 | CDD:293786 | |||
ANK 2. /evidence=ECO:0000255 | 81..110 | ||||
Ank_2 | 86..179 | CDD:289560 | |||
ANK repeat | 114..146 | CDD:293786 | |||
ANK 3. /evidence=ECO:0000255 | 115..144 | ||||
ANK repeat | 148..179 | CDD:293786 | |||
ANK 4. /evidence=ECO:0000255 | 148..177 | ||||
ANK | 176..>269 | CDD:238125 | |||
ANK repeat | 181..247 | CDD:293786 | |||
ANK 5. /evidence=ECO:0000255 | 181..211 | ||||
Ank_5 | 202..257 | CDD:290568 | |||
ANK 6. /evidence=ECO:0000255 | 216..245 | ||||
ANK 7. /evidence=ECO:0000255 | 249..277 | ||||
zf-DHHC | 423..556 | CDD:279823 | 32/139 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |