DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and Zdhhc22

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001074412.1 Gene:Zdhhc22 / 238331 MGIID:2685108 Length:263 Species:Mus musculus


Alignment Length:337 Identity:70/337 - (20%)
Similarity:106/337 - (31%) Gaps:135/337 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 YQICIKKVSDYLTIGLLLFFY-------------------HLLLFMFLWTWFRCIFVAPVRIPDQ 82
            |.:||..|    |..|.||.:                   |..||:||                 
Mouse    14 YFLCISLV----TFVLQLFLFLPSMREDPTATPLFSPAVLHGALFLFL----------------- 57

  Fly    83 WKISPEDVDKLKRNDGIEGASRVLNY--AARNLPIATCTIDGLVRYCKTCWIIKPDRAHHCRTCH 145
                              .|:.:.||  ..:|.|....|..|.:.....|   .|...|.||.|.
Mouse    58 ------------------SANALGNYVLVIQNSPDDLGTCQGTMSQRPQC---PPPSTHFCRVCS 101

  Fly   146 MCVLKMDHHCPWIVNCVHFHNFKYFILFLFYAEVYCFYLFCVMVYDLYLICGFEVTALKNQHSWN 210
            ...|:.||||.:..||:...|.:.||||..|..:.|.|         .::.|             
Mouse   102 RVTLRHDHHCFFTGNCIGSRNMRNFILFCLYTSLACLY---------SMVAG------------- 144

  Fly   211 ILQYLVCILFNIFTVIMYTVSLLNVSRNRTTMESAYATYFLLGGKNNNGFNLG--YFVNFRDLYG 273
             :.|:..:|         ::|..:.....|.:.::.:.:|       :|..||  .||..     
Mouse   145 -VAYISAVL---------SISFAHPLAFLTLLPTSISQFF-------SGAVLGSDMFVIL----- 187

  Fly   274 DKWYLWPFPIFSSRGDGFSFPLA------HDRLKEVR--TGNQKKDNQPTRTQMYKENMNRI--- 327
             ..|||           |:..||      |..|..:|  |..|.:.....|.:.:::|:..:   
Mouse   188 -MLYLW-----------FAVGLACAGFCCHQLLLILRGQTRYQVRKGMAVRARPWRKNLQEVFGK 240

  Fly   328 ---LGIHQPPFN 336
               ||:..|.||
Mouse   241 RWLLGLLVPMFN 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 26/117 (22%)
Zdhhc22NP_001074412.1 DHHC 91..218 CDD:366691 41/182 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.