DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and Zdhhc5

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_659136.1 Gene:Zdhhc5 / 228136 MGIID:1923573 Length:715 Species:Mus musculus


Alignment Length:266 Identity:73/266 - (27%)
Similarity:115/266 - (43%) Gaps:44/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PIGEGHRRVPCCAVRWLPALIILGFLVWSYHVFVYQICIKKVSDYLTIGLLLFFYHLLLFMFLWT 67
            |...|.|..|.   :::|......|||.:..:|....| ..:|  |.:...:..|:.::|:|:..
Mouse     2 PAESGKRFKPS---KYVPVSAAAIFLVGATTLFFAFTC-PGLS--LNVSPAVPIYNAIMFLFVLA 60

  Fly    68 WF-RCIFVAPVRIPDQWKISPEDVDKLKRNDGIEGASRVLNYAARNLPIATCTIDGL---VRYCK 128
            .| ...|:.|...|.    :.||.||       |...|...|       .|..|.|:   :::|.
Mouse    61 NFSMATFMDPGIFPR----AEEDEDK-------EDDFRAPLY-------KTVEIKGIQVRMKWCA 107

  Fly   129 TCWIIKPDRAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFYAEVYCFYLFCV-MVYDL 192
            ||...:|.|..||..|..||.:.||||||:.||:...|::||.|||.....:...:|.. ::|.|
Mouse   108 TCRFYRPPRCSHCSVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLLSLTAHIMGVFGFGLLYVL 172

  Fly   193 YLICGFEVTALKNQHSWNILQYLVCI--LFNIFTVIMYTVSLLNVSRNRTTMESAYATYFLLGGK 255
            |.|  .|::.::..    :...::|:  ||.|....:....::.|:|.|||.|.       :.||
Mouse   173 YHI--EELSGVRTA----VTMAVMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQ-------VTGK 224

  Fly   256 NNNGFN 261
            ...|.|
Mouse   225 FRGGVN 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 39/120 (33%)
Zdhhc5NP_659136.1 zf-DHHC 99..224 CDD:279823 40/137 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 289..715
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.