Sequence 1: | NP_611197.1 | Gene: | CG17287 / 36939 | FlyBaseID: | FBgn0034202 | Length: | 338 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_492960.1 | Gene: | dhhc-7 / 173045 | WormBaseID: | WBGene00007637 | Length: | 302 | Species: | Caenorhabditis elegans |
Alignment Length: | 271 | Identity: | 64/271 - (23%) |
---|---|---|---|
Similarity: | 105/271 - (38%) | Gaps: | 75/271 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 RWLPALIILGFLVWSYHVFVYQICIKKVSDYLTIGLLLF--FYHLLLFMFLWTWFRCIFVA---- 75
Fly 76 ------------------------PVRIPDQWKISPEDV----DKLKRNDGIEGASRVLNYAARN 112
Fly 113 LPIATCTIDGLVRYCKTCWIIKPDRAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFY- 176
Fly 177 --AEVYCFYLFCV--MVYDLYLICGFEVTALKNQHSWNILQYLV----CILFNIFTVIMYTVSLL 233
Fly 234 NVSRNRTTMES 244 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17287 | NP_611197.1 | zf-DHHC | 125..243 | CDD:279823 | 40/126 (32%) |
dhhc-7 | NP_492960.1 | zf-DHHC | 115..240 | CDD:279823 | 40/124 (32%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1491968at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |