DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and ZDHHC19

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001034706.1 Gene:ZDHHC19 / 131540 HGNCID:20713 Length:309 Species:Homo sapiens


Alignment Length:272 Identity:59/272 - (21%)
Similarity:93/272 - (34%) Gaps:103/272 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LLLFFYHLLLFMFLWTW----------------FRCIFVAPVRIPDQWKISPEDVDKLKRNDGIE 100
            :||.|:..|.|.|...|                |...|.:.|      .::..|...|.:....:
Human    36 VLLVFFSGLFFAFPCRWLAQNGEWAFPVITGSLFVLTFFSLV------SLNFSDPGILHQGSAEQ 94

  Fly   101 GASRV----LNYAARNLPIATCTIDGLVRYCKTCWIIKPDRAHHCRTCHMCVLKMDHHCPWIVNC 161
            |...|    :|:.|..|           ::|..|...:|.|.:||..|::||...||||.|:.||
Human    95 GPLTVHVVWVNHGAFRL-----------QWCPKCCFHRPPRTYHCPWCNICVEDFDHHCKWVNNC 148

  Fly   162 VHFHNFKYFILFLFYAEVYCFYLFCVMVYDLYLICGFEVTALKNQHSWNILQYLVCILFNIFTV- 225
            :...||::|:|.:.   ..|.|...::|                          .|::|.:.|. 
Human   149 IGHRNFRFFMLLVL---SLCLYSGAMLV--------------------------TCLIFLVRTTH 184

  Fly   226 -------------------IMYTVSLLNVSRNRTTMESAYATYFLLGGK-----NNNGFNLGYFV 266
                               ::..:|||.:.: ..::.||..||   .||     ..|.|:.|...
Human   185 LPFSTDKAIAIVVAVSAAGLLVPLSLLLLIQ-ALSVSSADRTY---KGKCRHLQGYNPFDQGCAS 245

  Fly   267 NFRDLYGDKWYL 278
            |        |||
Human   246 N--------WYL 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 29/137 (21%)
ZDHHC19NP_001034706.1 DHHC 109..>181 CDD:366691 26/111 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..309
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.