DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and Zdhhc7

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_598728.1 Gene:Zdhhc7 / 102193 MGIID:2142662 Length:308 Species:Mus musculus


Alignment Length:246 Identity:60/246 - (24%)
Similarity:104/246 - (42%) Gaps:57/246 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CCAVRWLPALIILGFLVWSYHVFVYQICIKKVSDYLTIGLLLFFYHLLLFMFLWTWFRCIFVAPV 77
            |..:.|| .::...|:|    .||..:..|.....:..|:|   ::.|..:.|.:..|.:...|.
Mouse    50 CAVMTWL-LVVYADFVV----TFVMLLPSKDFWYSVVNGVL---FNCLAVLALSSHLRTMLTDPG 106

  Fly    78 RIPDQWKISPEDVDKLKRNDGIEGASRVLNYAARNLPIATCTIDGLVRYCKTCWIIKPDRAHHCR 142
            .:| :...:.|.::.|:...|                       .::..|..|..|||:|||||.
Mouse   107 AVP-KGNATKEYMESLQLKPG-----------------------EVIYKCPKCCCIKPERAHHCS 147

  Fly   143 TCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFYAEVYCFYLFCVMVYDLYLICGFE-VTALKNQ 206
            .|..|:.||||||||:.|||...|.::|:||..|..:...:..        ::||.: ::.::.|
Mouse   148 ICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTMYIALSSVHAL--------ILCGLQFISCVRGQ 204

  Fly   207 HSWN-----------ILQYLVC---ILFNIFTVIMYTVSLLNVSRNRTTME 243
              |.           ||...:|   :||..||.:|:...:.::..:.|.:|
Mouse   205 --WTECSDFSPPITVILLVFLCLEGLLFFTFTAVMFGTQIHSICNDETEIE 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 41/132 (31%)
Zdhhc7NP_598728.1 DHHC 131..258 CDD:366691 42/133 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848304
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.