DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and zdhhc7

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_002936046.1 Gene:zdhhc7 / 100485887 XenbaseID:XB-GENE-944330 Length:304 Species:Xenopus tropicalis


Alignment Length:258 Identity:67/258 - (25%)
Similarity:106/258 - (41%) Gaps:81/258 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CCAVRWLPALIILGFLVWSYHVFVYQICIKKVSDYLTIGLLL----FFYHLL---LF-----MFL 65
            |..:.||        ||: |..||           :|..:||    |:|.::   ||     :.|
 Frog    47 CAVITWL--------LVF-YADFV-----------VTFVMLLPSRDFWYSVINGTLFNCLAVLAL 91

  Fly    66 WTWFRCIFVAPVRIPDQWKISPEDVDKLKRNDGIEGASRVLNYAARNLPIATCTIDGLVRYCKTC 130
            .:..|.:...|..:| :...:.|.::.|:...|                       .::..|..|
 Frog    92 TSHLRTMLTDPGAVP-KGNATKEYMESLQLKPG-----------------------EVIYKCPKC 132

  Fly   131 WIIKPDRAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFYAEVYCFYLFCVMVYDLYLI 195
            ..|||:|||||..|..|:.||||||||:.|||...|.::|:||..|..:...|..        ::
 Frog   133 CSIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTMYIALISTYAL--------IL 189

  Fly   196 CGFEV-TALKNQHSWN-----------ILQYLVC---ILFNIFTVIMYTVSLLNVSRNRTTME 243
            ||.:: |.:|.|  |.           ||...:|   :||..||.:|:...:.::..:.|.:|
 Frog   190 CGLQLFTCVKGQ--WTACSSFSPPVTVILMIFLCLEGLLFLTFTAVMFGTQIHSICNDETEIE 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 44/132 (33%)
zdhhc7XP_002936046.1 DHHC 128..255 CDD:366691 45/133 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.