DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17287 and zdhhc21

DIOPT Version :9

Sequence 1:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001116527.1 Gene:zdhhc21 / 100144560 ZFINID:ZDB-GENE-080401-2 Length:263 Species:Danio rerio


Alignment Length:292 Identity:73/292 - (25%)
Similarity:110/292 - (37%) Gaps:93/292 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 FLVWSYHVFVYQICIKKV-------SDYLTIGLLLFFY--HLLLFMFLWTWFRCIFVAPVRIPDQ 82
            |.||.|:.|:    |.|:       ..::|...::.:|  .||.|..|                 
Zfish    21 FFVWIYNSFL----IPKLVLLPHYAEGHITAEPVICYYLASLLCFSAL----------------- 64

  Fly    83 WKISPEDVDKLKRNDGIEGASRVLNYAARNLPIATCTIDGLVRYCKTCWIIKPDRAHHCRTCHMC 147
            ::.|..|..||.::..|..|.|. |:                ..|..|.:::|.|:|||..|..|
Zfish    65 FRASTTDPGKLAQDPKIPLAERD-NW----------------ELCNKCNMMRPKRSHHCSRCGHC 112

  Fly   148 VLKMDHHCPWIVNCVHFHNFKYFILFLFYAEVYCFYL----FCVMVYDLYLI----CGFEVTALK 204
            |.:||||||||.|||...|...|:...||.:|..||.    ||...|.|.|.    ..|.|    
Zfish   113 VRRMDHHCPWINNCVGEDNHWLFLQLCFYTQVLSFYTLVLDFCQYYYFLPLSSVDQADFAV---- 173

  Fly   205 NQHSWNILQ---YLVCILFNIFTVIMYTVSLLNVSRNRTTMESAYATYFLLGGKNNNGFNLGYFV 266
             .|...:|:   ::..|:|...:.:.|| .:..:..:.||:|                 .:.:..
Zfish   174 -HHELALLRVSCFMGLIMFGGISSLFYT-QVKGILTDTTTIE-----------------KMSHLT 219

  Fly   267 N----------FRDLYGDKW-YLWPFPIFSSR 287
            .          ..:::|.:| .||..| |.||
Zfish   220 EEVPRRPWQQAMAEVFGTRWKVLWFLP-FRSR 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 43/128 (34%)
zdhhc21NP_001116527.1 zf-DHHC 87..217 CDD:279823 45/169 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593719
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.