DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17290 and CG31626

DIOPT Version :10

Sequence 1:NP_611196.2 Gene:CG17290 / 36938 FlyBaseID:FBgn0034201 Length:99 Species:Drosophila melanogaster
Sequence 2:NP_724320.1 Gene:CG31626 / 318859 FlyBaseID:FBgn0051626 Length:285 Species:Drosophila melanogaster


Alignment Length:103 Identity:42/103 - (40%)
Similarity:52/103 - (50%) Gaps:22/103 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLIIAIAFLACAFADVSEL---SGYDYQQPAP------APVETYIPP-----APPAPAPVETY 51
            ||..:.|:..:|.|.||||.|   |||.|.:|.|      ||...|:||     :.||||||.:.
  Fly     1 MKLFVFAVCAIALASADVSHLNLGSGYSYNKPTPTFNIPSAPAPAYLPPVQEVISAPAPAPVYSA 65

  Fly    52 IPPAP------PAPEYIPPAPVQAEE--PIIEEIEQPA 81
            ..|||      |||.|..|||....|  |.:::|..||
  Fly    66 PAPAPVYSAPAPAPVYSAPAPAPVSEYLPPVQDIPAPA 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17290NP_611196.2 GYR 82..99 CDD:128953 42/103 (41%)
CG31626NP_724320.1 PRK12323 <45..>222 CDD:481241 24/59 (41%)

Return to query results.
Submit another query.