DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17290 and CG30458

DIOPT Version :9

Sequence 1:NP_001286522.1 Gene:CG17290 / 36938 FlyBaseID:FBgn0034201 Length:99 Species:Drosophila melanogaster
Sequence 2:NP_725663.1 Gene:CG30458 / 246624 FlyBaseID:FBgn0050458 Length:145 Species:Drosophila melanogaster


Alignment Length:145 Identity:87/145 - (60%)
Similarity:91/145 - (62%) Gaps:46/145 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLIIAIAFLACAFADVSE--LSGYDYQQPA-PAPVETYIPPAPPAP----------------- 45
            |||||||:||||||:|||||  ..||||.||| ||||::||||.||.|                 
  Fly     1 MKFLIIAVAFLACAYADVSEPAAGGYDYPQPAPPAPVKSYIPPPPPPPPPAPKNTYIPPPAAPAK 65

  Fly    46 --------------------------APVETYIPPAPPAPEYIPPAPVQAEEPIIEEIEQPAQDG 84
                                      ||||||||||.|||.||||||||||||||||||||||||
  Fly    66 AYIPPPPPPPPPAPKNTYIPPAPAPVAPVETYIPPAAPAPAYIPPAPVQAEEPIIEEIEQPAQDG 130

  Fly    85 YRYKTVRRHVFRHRN 99
            ||||||||.||||||
  Fly   131 YRYKTVRRRVFRHRN 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17290NP_001286522.1 GYR 82..99 CDD:128953 15/16 (94%)
CG30458NP_725663.1 GYR 128..145 CDD:128953 15/16 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444763
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28KU4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014283
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.