DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17290 and C16B8.3

DIOPT Version :9

Sequence 1:NP_001286522.1 Gene:CG17290 / 36938 FlyBaseID:FBgn0034201 Length:99 Species:Drosophila melanogaster
Sequence 2:NP_508686.1 Gene:C16B8.3 / 180681 WormBaseID:WBGene00015823 Length:164 Species:Caenorhabditis elegans


Alignment Length:76 Identity:23/76 - (30%)
Similarity:29/76 - (38%) Gaps:16/76 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SGYDYQQPAPAPV-ETYIPPAP---PAPAPVETYIPPAPPAP--------EYIPPAPVQAEEPII 74
            :|..|..|.|.|. .||.||.|   .|......|:..|||.|        :..||.|.|..:..:
 Worm    46 AGVGYAPPPPRPYGATYAPPPPMGIGAGVNPSGYVQQAPPLPTQGYSAYNQQPPPLPQQPYQTNM 110

  Fly    75 EEIEQPAQDGY 85
                .|:..||
 Worm   111 ----YPSNPGY 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17290NP_001286522.1 GYR 82..99 CDD:128953 2/4 (50%)
C16B8.3NP_508686.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28KU4
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.