DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cda9 and verm

DIOPT Version :9

Sequence 1:NP_001286519.1 Gene:Cda9 / 36934 FlyBaseID:FBgn0034197 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001163469.1 Gene:verm / 40149 FlyBaseID:FBgn0261341 Length:555 Species:Drosophila melanogaster


Alignment Length:424 Identity:132/424 - (31%)
Similarity:196/424 - (46%) Gaps:60/424 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GLILTVALMSEAKSKSKKQKNKQNGILPMAEP-----CKPSKCKLPDCRCSDAALPTSKFQG--K 67
            |..|...|....||..|.:.: :|......:|     |.|::|.||||.||   ...::..|  :
  Fly   148 GECLDKELFCNGKSDCKDESD-ENACSVDEDPNRAPECDPTQCALPDCFCS---ADGTRIPGGIE 208

  Fly    68 ENQIPQFVTITFDDAVNAVNFAQYELLFDG-LINPDGCGAAGTFFLSHEYTDYVRVNALYRAGHE 131
            ..|:||.:||||:.|||..|...||.:|:| ..||:||...||||:||:||:|..|..|:|.|||
  Fly   209 PQQVPQMITITFNGAVNVDNIDLYEDIFNGQRQNPNGCSIKGTFFVSHKYTNYSAVQDLHRRGHE 273

  Fly   132 IALHSVTHGDGTDYWRSADVPTIEREFGAQLKMLETFAKVNPKKIQGMRLPFLQISGNNTFEAAR 196
            |::.|:||.|..:||..........|......::|.||.:....|.|||.|:|::.||..||...
  Fly   274 ISVFSLTHKDDPNYWTGGSYDDWLAEMAGSRLIVERFANITDGSIIGMRAPYLRVGGNKQFEMMA 338

  Fly   197 RLGLTYDSSWPTQKFKDPAMWPYTLDYKSKQDC--QIGPCPEASIPGFWVNPMVTWT-------- 251
            .....||:|......:.| :|||||.::....|  ....||..|.|        .|.        
  Fly   339 DQFFVYDASITASLGRVP-IWPYTLYFRMPHKCNGNAHNCPSRSHP--------VWEMVMNELDR 394

  Fly   252 ------DTEGYSCSMIDACVYPPEDDMDELFDWMMENFNRHYLGNRAPFGMYLHAAWFSRGRNYF 310
                  |.....|.|:|:|......  |:....:..||||||..||||.|::.||:|....:.|.
  Fly   395 RDDPTFDESLPGCHMVDSCSNVASG--DQFARLLRHNFNRHYNSNRAPLGLHFHASWLKSKKEYR 457

  Fly   311 GAFKKFINHLNTYSDVYFTGISRMLEYVRKPTLGSPFKDCPDLPEAECRAVQCHVQ--------- 366
            ....|||..:...:||:|....:::::::.||..:..:|..:..|      :|.|:         
  Fly   458 DELIKFIEEMLGRNDVFFVTNLQVIQWMQNPTELNSLRDFQEWKE------KCDVKGQPYCSLPN 516

  Fly   367 --KMST----GEERYMTVCDKCPSVYPWLDNPLG 394
              .::|    ||...:..|.:||:.|||:.:|.|
  Fly   517 ACPLTTRELPGETLRLFTCMECPNNYPWILDPTG 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cda9NP_001286519.1 CE4_CDA_like_2 72..341 CDD:200597 96/285 (34%)
vermNP_001163469.1 CBM_14 57..118 CDD:366726
LDLa 138..172 CDD:238060 7/24 (29%)
CE4_CDA_like_1 213..488 CDD:200596 96/285 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1060206at2759
OrthoFinder 1 1.000 - - FOG0003270
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.