DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cda9 and ChLD3

DIOPT Version :9

Sequence 1:NP_001286519.1 Gene:Cda9 / 36934 FlyBaseID:FBgn0034197 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_609806.1 Gene:ChLD3 / 35002 FlyBaseID:FBgn0032598 Length:577 Species:Drosophila melanogaster


Alignment Length:385 Identity:140/385 - (36%)
Similarity:196/385 - (50%) Gaps:49/385 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 AEPCKPSKCKLPDCRCS------DAALPTSKFQGKENQIPQFVTITFDDAVNAVNFAQYELLFDG 97
            |..|.|.||.||.|.||      ..:||.       ..:||.:.:|||||:|..|:.    ||..
  Fly   211 AGACDPRKCHLPQCFCSKDGTQIPGSLPA-------QSVPQMILLTFDDAINHDNWE----LFSK 264

  Fly    98 LI------NPDGCGAAGTFFLSHEYTDYVRVNALYRAGHEIALHSVTHGDGTDYWRSADVPTIE- 155
            ::      ||:||...|||::||.:|:|..|..|:..|||||:||||| .|.:.|.|.:. ||| 
  Fly   265 VLFTQHRRNPNGCPIKGTFYVSHPFTNYQYVQKLWNDGHEIAVHSVTH-RGPEMWWSKNA-TIED 327

  Fly   156 --REFGAQLKMLETFAKVNPKKIQGMRLPFLQISGNNTFEAARRLGLTYDSSWPTQKFKDPAMWP 218
              .|...|..::..||.|..::|:|||:|||::..|..|...:..|..||||. .....:|.:||
  Fly   328 WFDEMVGQANIINKFAAVRMEEIRGMRVPFLRVGWNRQFLMMKEFGFVYDSSM-VAPHSNPPLWP 391

  Fly   219 YTLDYKSKQDCQIG---PCPEASIPGFWVNPMVTWTDTEGYSCSMIDACVYPPEDDMDELFDWMM 280
            ||||||....| .|   .||..|.||.| ..::...:...|.|.|:|.|  ||....::::..:.
  Fly   392 YTLDYKMPHSC-TGVNQNCPSRSYPGIW-ELVMNQLEVGEYMCGMVDTC--PPHLSGEDVYRMLT 452

  Fly   281 ENFNRHYLGNRAPFGMYLHAAWFSRGRNYFGAFKKFINHLNTYSDVYFTGISRMLEYVRKPTLGS 345
            .||.||||.||||||:|.|:.||.: .:|..||.||::.|....||:|....:.::::|.||..:
  Fly   453 HNFKRHYLSNRAPFGLYFHSTWFKK-VDYLNAFLKFLDDLQKLPDVFFVTNQQAIQWMRHPTPSN 516

  Fly   346 PF----------KDCPDLPEAECRAVQ-CHVQKMSTGEERYMTVCDKCPSVYPWLDNPLG 394
            ..          ||. |..|..|.... |.|:.....|:|:...|.:||:.|||:.|..|
  Fly   517 QLHQFESWHCQPKDL-DPHEQVCNTPNVCKVRSRVLQEDRFFYTCMECPAQYPWIRNEFG 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cda9NP_001286519.1 CE4_CDA_like_2 72..341 CDD:200597 109/280 (39%)
ChLD3NP_609806.1 CBM_14 <111..149 CDD:279884
LDLa 168..202 CDD:238060
CE4_CDA_like_1 243..512 CDD:200596 109/280 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1060206at2759
OrthoFinder 1 1.000 - - FOG0003270
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.