DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cda9 and lgx-1

DIOPT Version :9

Sequence 1:NP_001286519.1 Gene:Cda9 / 36934 FlyBaseID:FBgn0034197 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001360720.1 Gene:lgx-1 / 180825 WormBaseID:WBGene00002983 Length:1754 Species:Caenorhabditis elegans


Alignment Length:413 Identity:131/413 - (31%)
Similarity:207/413 - (50%) Gaps:72/413 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SKKQKNKQNGILPMAEPCKPSKCKLPDCRCSDAALPTSKFQG--KENQIPQFVTITFDDAVNAVN 87
            |.:..|:|.     |:.|..::||||:|.|::..   .:..|  :.::.||||.:|||||||...
 Worm  1368 SMQVPNRQR-----AQACNEAECKLPNCFCTENG---RRAPGGLRPDETPQFVVLTFDDAVNGKT 1424

  Fly    88 FAQYELLF--DGLINPDGCGAAGTFFLSHEYTDYVRVNALYRAGHEIALHSVTH----GDGTDYW 146
            |:.|:.||  |.|.||:||....|||:|||:|:|..||.|.:...|||.:|::|    ...|:.|
 Worm  1425 FSDYKKLFENDVLKNPNGCDVKATFFISHEWTNYDAVNWLVQKNMEIASNSISHESLENANTNRW 1489

  Fly   147 RSADVPTIEREFGAQLKMLETFAKVNPKKIQGMRLPFLQISGNNTFEAARRLGLTYDSSWPTQKF 211
            .:        |...|.::|..|.....::|.|:|.|.|.:.|:|.||  ..:|..:  .|.....
 Worm  1490 LN--------EMDGQRRILAKFGGAPEEEIVGIRSPQLALGGDNQFE--MMIGAEF--LWDNSMS 1542

  Fly   212 KDPAM-----WPYTLDYKSKQDCQIGPCPEASIPGFWVNPM-------VTWTDTEGYSCSMIDAC 264
            .:|.:     ||.|:||:...||....||::|.||.|..|:       ::..|:...| ||:.|.
 Worm  1543 ANPGIHGEPFWPQTMDYQVAWDCNEASCPKSSFPGVWSVPLNQFYGSYMSQIDSFRRS-SMLRAA 1606

  Fly   265 VYPPEDDMDELFDWMMENFNRHYLGNRAPFGMYLHAAWFSRGRNYFG--AFKKFINHLNTYSDVY 327
            | ...:.:|||.:.:..||.|.|..||||:.:.|:|.:...|.:..|  |.:||:|.::...|||
 Worm  1607 V-DLNNTVDELEEIITRNFERSYSANRAPYVLSLNADFLQLGGHNKGMKAVQKFLNRMSAQKDVY 1670

  Fly   328 FTGISRMLEYVRKPTLGSPFKD-----CP--------------DLPEAECRAVQC--HVQKMSTG 371
            ...|.::::::::|...|..|.     ||              |:|.      :|  ....:|:.
 Worm  1671 IVTIKQLIDWMKRPVPISEMKSSKAVGCPITLSFNRNPSLSTCDIPN------KCLYSTPSLSSQ 1729

  Fly   372 EERYMTVCDKCPSVYPWLDNPLG 394
            |.:::| |..||::||||:||.|
 Worm  1730 EHQFLT-CLPCPTMYPWLENPAG 1751

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cda9NP_001286519.1 CE4_CDA_like_2 72..341 CDD:200597 98/288 (34%)
lgx-1NP_001360720.1 EB 322..382 CDD:366756
PHA02682 <388..>493 CDD:177464
EB 565..620 CDD:366756
EB 609..666 CDD:366756
EB <718..757 CDD:366756
EB 911..967 CDD:366756
EB 956..1020 CDD:366756
EB 1009..1083 CDD:366756
EB 1072..1124 CDD:366756
EB <1215..1253 CDD:366756
EB 1242..1301 CDD:366756
EB 1290..1346 CDD:366756
CE4_CDA_like_1 1409..1684 CDD:200596 98/288 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003270
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.