powered by:
Protein Alignment CG15605 and AT1G51730
DIOPT Version :9
Sequence 1: | NP_611191.1 |
Gene: | CG15605 / 36933 |
FlyBaseID: | FBgn0034196 |
Length: | 152 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_175584.1 |
Gene: | AT1G51730 / 841598 |
AraportID: | AT1G51730 |
Length: | 252 |
Species: | Arabidopsis thaliana |
Alignment Length: | 56 |
Identity: | 16/56 - (28%) |
Similarity: | 33/56 - (58%) |
Gaps: | 0/56 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 82 LQLLFTCAANYPLARPLVEIVEKRNVSDAFEQVLRKEIDLILEEHLGLQMIVPVVT 137
|.|:|:...|||...||:::...|.:..:...:|:::::....|:||:.||..:|:
plant 61 LALVFSHTENYPDEAPLLDVKSIRGIHVSDLTILKEKLEQEASENLGMAMIYTLVS 116
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG15605 | NP_611191.1 |
RWD |
33..145 |
CDD:214735 |
16/56 (29%) |
AT1G51730 | NP_175584.1 |
RWD |
6..122 |
CDD:399058 |
16/56 (29%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4018 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0003763 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.