DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15605 and RWDD1

DIOPT Version :9

Sequence 1:NP_611191.1 Gene:CG15605 / 36933 FlyBaseID:FBgn0034196 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_057036.2 Gene:RWDD1 / 51389 HGNCID:20993 Length:243 Species:Homo sapiens


Alignment Length:131 Identity:36/131 - (27%)
Similarity:58/131 - (44%) Gaps:20/131 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QENEVRTMHYL-GLAYVVLSRRPNLQLKVPLSTQNYEDGAIVGAGERGGYALQLLFTCAANYPLA 95
            |.||:..:..: ..::.|||..|. ...:.::::..|:...|        ...|.||.:..||..
Human     8 QRNELEALESIYPDSFTVLSENPP-SFTITVTSEAGENDETV--------QTTLKFTYSEKYPDE 63

  Fly    96 RPLVEIVEKRNVSDAFEQVLRKEIDLILEEHLGLQMIVPVVTRLQITLN----------TEMKRQ 150
            .||.||..:.|:.|.....:.|.:.|..||:||:.||..:||.:|..||          .|.|:|
Human    64 APLYEIFSQENLEDNDVSDILKLLALQAEENLGMVMIFTLVTAVQEKLNEIVDQIKTRREEEKKQ 128

  Fly   151 R 151
            :
Human   129 K 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15605NP_611191.1 RWD 33..145 CDD:214735 32/122 (26%)
RWDD1NP_057036.2 RWD 6..111 CDD:368608 31/111 (28%)
Interaction with DRG2. /evidence=ECO:0000250 142..197
DFRP_C <144..217 CDD:374615
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..243
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4018
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003763
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.