DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15605 and CG5515

DIOPT Version :9

Sequence 1:NP_611191.1 Gene:CG15605 / 36933 FlyBaseID:FBgn0034196 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001262901.1 Gene:CG5515 / 42875 FlyBaseID:FBgn0039163 Length:244 Species:Drosophila melanogaster


Alignment Length:130 Identity:41/130 - (31%)
Similarity:67/130 - (51%) Gaps:8/130 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ARYFRDLQENEVRTMH--YLGLAYVVLSRRPNLQLKVPLSTQNYEDGAIVGAGERGGYALQLLFT 87
            :|.:::.|.|||..:.  |.| ...:|:..|:.:.::|::|:.|.     ......|.|.:|:||
  Fly     2 SRNYKEDQTNEVEALDSIYCG-DMEILATEPHHKFQIPIATEEYS-----SEEPEKGLACKLVFT 60

  Fly    88 CAANYPLARPLVEIVEKRNVSDAFEQVLRKEIDLILEEHLGLQMIVPVVTRLQITLNTEMKRQRF 152
            ..|.||...|:|||.|..|..|.||..|.:.:...:||:||::||..:|:..|..||......:|
  Fly    61 FTATYPDGAPVVEIEEPENFEDMFETRLLEHLQKTIEENLGMEMIFSLVSSAQEWLNERWDEHKF 125

  Fly   153  152
              Fly   126  125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15605NP_611191.1 RWD 33..145 CDD:214735 37/113 (33%)
CG5515NP_001262901.1 RWD 4..116 CDD:283440 37/117 (32%)
DFRP_C 149..>198 CDD:293151
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3088
eggNOG 1 0.900 - - E1_KOG4018
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003763
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.