DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15605 and Rwdd1

DIOPT Version :10

Sequence 1:NP_611191.1 Gene:CG15605 / 36933 FlyBaseID:FBgn0034196 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_671487.1 Gene:Rwdd1 / 259218 RGDID:631337 Length:243 Species:Rattus norvegicus


Alignment Length:131 Identity:36/131 - (27%)
Similarity:58/131 - (44%) Gaps:20/131 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QENEVRTMHYL-GLAYVVLSRRPNLQLKVPLSTQNYEDGAIVGAGERGGYALQLLFTCAANYPLA 95
            |.||:..:..: ..::.|||..|. ...:.::::..|:...|        ...|.||.:..||..
  Rat     8 QRNELEALESIYPDSFTVLSENPP-SFTITVTSEAGENDETV--------QTTLKFTYSEKYPDE 63

  Fly    96 RPLVEIVEKRNVSDAFEQVLRKEIDLILEEHLGLQMIVPVVTRLQITLN----------TEMKRQ 150
            .||.||..:.|:.|.....:.|.:.|..||:||:.||..:||.:|..||          .|.|:|
  Rat    64 APLYEIFSQENLEDNDVSDILKLLALQAEENLGMVMIFTLVTAVQEKLNEIVDQIKTRREEEKKQ 128

  Fly   151 R 151
            :
  Rat   129 K 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15605NP_611191.1 RWD 33..145 CDD:214735 32/122 (26%)
Rwdd1NP_671487.1 RWD_RWDD1 4..119 CDD:467652 33/119 (28%)
Interaction with DRG2. /evidence=ECO:0000250 142..197
DFRP_C <144..>197 CDD:465167
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..243
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.