DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15605 and RWDD4

DIOPT Version :9

Sequence 1:NP_611191.1 Gene:CG15605 / 36933 FlyBaseID:FBgn0034196 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_689895.2 Gene:RWDD4 / 201965 HGNCID:23750 Length:188 Species:Homo sapiens


Alignment Length:62 Identity:14/62 - (22%)
Similarity:29/62 - (46%) Gaps:7/62 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 GERG---GYALQLLFTCAANYPLARPLVEI--VEKRNVSDAFEQVLRKEIDLILEEHLGLQM 131
            ||.|   .:.:::.:|  ..||...|::.:  .....:|.|.:|.:..::...:|.:||..|
Human    37 GENGDPKAFLIEISWT--ETYPQTPPILSMNAFFNNTISSAVKQSILAKLQEAVEANLGTAM 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15605NP_611191.1 RWD 33..145 CDD:214735 14/62 (23%)
RWDD4NP_689895.2 RWD 5..107 CDD:399058 14/62 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 132..167
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4018
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.