powered by:
Protein Alignment CG15605 and Rwdd4a
DIOPT Version :9
Sequence 1: | NP_611191.1 |
Gene: | CG15605 / 36933 |
FlyBaseID: | FBgn0034196 |
Length: | 152 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_987103.1 |
Gene: | Rwdd4a / 192174 |
MGIID: | 2681000 |
Length: | 188 |
Species: | Mus musculus |
Alignment Length: | 74 |
Identity: | 17/74 - (22%) |
Similarity: | 34/74 - (45%) |
Gaps: | 8/74 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 60 PLSTQNYEDGAIVGAGERGGYALQLLFTCAANYPLARPLVEI--VEKRNVSDAFEQVLRKEIDLI 122
|:|.| |..|. .|:...:.:::.:| ..||...|::.: .....:|.|.:|.:..::...
Mouse 29 PVSFQ-YRIGE---DGDPKAFLIEVSWT--ETYPQTAPVISMNAFFNNTISSAVKQSILAKLQEA 87
Fly 123 LEEHLGLQM 131
:|.:||..|
Mouse 88 VEVNLGTAM 96
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4018 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.