DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amy-d and IMA5

DIOPT Version :9

Sequence 1:NP_523768.1 Gene:Amy-d / 36932 FlyBaseID:FBgn0000078 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_012319.1 Gene:IMA5 / 853214 SGDID:S000003752 Length:581 Species:Saccharomyces cerevisiae


Alignment Length:509 Identity:95/509 - (18%)
Similarity:168/509 - (33%) Gaps:167/509 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 WDDIAAECE--NFLGPNGYAGVQVSPVNENAVKDSRPWWERYQPISY-KLETRSGNEEQFASMVK 100
            |.|:|....  :::...|...:.|.|..::..:|.     .|...:| |:..|.|..|....|::
Yeast    31 WGDLAGITSKLDYVKELGVDAIWVCPFYDSPQEDM-----GYDIANYEKVWPRYGTNEDCFQMIE 90

  Fly   101 RCNAVGVRTYVDVVFNHMAADGGTY-GTGGSTASPSSKSYPGVPYSSLD--FNPTCAISNYNDAN 162
            ..:..|::..||:|.||.:.:...: .:..|.|:|....:...|....|  .|| ...:|:    
Yeast    91 EAHKRGIKVIVDLVINHCSEEHEWFKESRSSKANPKRDWFFWRPPKGYDEKGNP-IPPNNW---- 150

  Fly   163 EVRNCELVGLRDLNQGNSYVQD-KVVEFLDHLIDLG---------------------------VA 199
                      |....|:::..| |..||..|:..||                           |.
Yeast   151 ----------RSFFGGSAWRYDEKTGEFFLHVFALGQPDFNWENEECRKAIYDSSVGYWLRHNVD 205

  Fly   200 GFRVDAAKHMWPADLAVIYGRLKNLN----TD------------------HGFASGSKAYIV--- 239
            |||:|...         :|.:::.|.    ||                  |.:......|::   
Yeast   206 GFRIDVGS---------MYSKVEGLPDAPITDPTVPYQKGTEFFINGPRIHEYHKEMHNYMLSQV 261

  Fly   240 ---QEVIDMGGEAISKSE----YTG-----LGAITEFRHSDSIGK---------VFRGKD----- 278
               :|::.:|...|...:    ||.     |..:..|:|: |:|:         .|..||     
Yeast   262 PEGKEIMTVGEVGIGNEDDFRVYTSAKEGELNMMFNFKHT-SVGENPKCKYELIPFTLKDFKLAL 325

  Fly   279 --QLQYLTN---WGTAWGFAASDRSLVFVDNHDNQRGHGAGGADVLTYKVPKQYKMAS---AFML 335
              ...::.|   |.|           ::::|||..|.....|:|     .||..:::|   |.::
Yeast   326 AESFLFIENTDCWST-----------IYLENHDQPRSVSRFGSD-----SPKWREISSKMLATLI 374

  Fly   336 AHPFGTPRVMSSFSFTDTDQGPPTTDGHNIASPIFNSDNSCSGGWVCEHRWRQIY-----NMVAF 395
            ....||     .|.:...:.|.|......|      ....|..|.......::.|     .|..|
Yeast   375 ISLTGT-----VFIYQGQELGMPNFKNRKI------EQIKCVEGTGTYAAIKRDYGEDSEKMKKF 428

  Fly   396 RNAVGLDEIQNW-----WDSGSNQISFSRGSRGFVAFNNDNYDLNSSLQTGLPA 444
            ..|:.|....:.     |.:......||:.::.::       |:|.|.:.|:.|
Yeast   429 FEALALISRDHGRTPFPWSADEPSAGFSKDAKPWI-------DMNESFRDGINA 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Amy-dNP_523768.1 AmyAc_bac_euk_AmyA 28..399 CDD:200456 85/457 (19%)
Alpha-amylase 54..342 CDD:278554 72/378 (19%)
Aamy_C 405..493 CDD:214749 8/45 (18%)
IMA5NP_012319.1 AmyAc_SI_OligoGlu_DGase 11..498 CDD:200472 95/509 (19%)
Malt_amylase_C 509..>548 CDD:413446
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157342130
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.