DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amy-d and MAL12

DIOPT Version :9

Sequence 1:NP_523768.1 Gene:Amy-d / 36932 FlyBaseID:FBgn0000078 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_011808.3 Gene:MAL12 / 853209 SGDID:S000003524 Length:584 Species:Saccharomyces cerevisiae


Alignment Length:453 Identity:82/453 - (18%)
Similarity:135/453 - (29%) Gaps:186/453 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 WDDIAAECE--NFLGPNGYAGVQVSPVNENAVKDSRPWWERYQPISY-KLETRSGNEEQFASMVK 100
            |.|:.....  .::...|...:.|.|..::..:|.     .|...:| |:....|..|....::.
Yeast    35 WGDLKGITSKLQYIKDLGVDAIWVCPFYDSPQQDM-----GYDISNYEKVWPTYGTNEDCFELID 94

  Fly   101 RCNAVGVRTYVDVVFNHMAADGGTYGTGGSTASPSSKSYP----------------GVPY----- 144
            :.:.:|::...|:|.||.:.:...:     ..|.|||:.|                |.|.     
Yeast    95 KTHKLGMKFITDLVINHCSTEHEWF-----KESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNW 154

  Fly   145 ------SSLDFNPTCAISNYNDANEVRNCELVGLR--DLNQGNSYVQDKVVE-----FLDHLIDL 196
                  |:..|:.|        .||. ...|...|  |||..|...:..:.|     :|||    
Yeast   155 KSFFGGSAWTFDET--------TNEF-YLRLFASRQVDLNWENEDCRRAIFESAVGFWLDH---- 206

  Fly   197 GVAGFRVDAAKHMWPADLAVIYGRLKNLNTDHGFASGSKAYIVQEVIDMGGEAISKSEYTGLGAI 261
            ||.|||:|.|.         :|.:...|                                     
Yeast   207 GVDGFRIDTAG---------LYSKRPGL------------------------------------- 225

  Fly   262 TEFRHSDSIGKVFRGKDQLQYLTNWGTAWG----------------FAASDRSLVFVDNHDNQRG 310
                 .||  .:|....:||: .|||:..|                .....|.::.|       |
Yeast   226 -----PDS--PIFDKTSKLQH-PNWGSHNGPRIHEYHQELHRFMKNRVKDGREIMTV-------G 275

  Fly   311 HGAGGADVLTYKVPKQYKMASAFMLAHPFGTPRVMSSFSFTDTDQGPPTTDGHNIASPIFNSDNS 375
            ..|.|:|...|....:|:::..               ||||..:.|         .||.|.    
Yeast   276 EVAHGSDNALYTSAARYEVSEV---------------FSFTHVEVG---------TSPFFR---- 312

  Fly   376 CSGGWVCEHRWRQIYNMVAFRNAVGLDEIQNWWDSGSNQISFSRGSRGFVAFNNDNYDLNSSL 438
                          ||:|.|       .::.|.::.::...|..|:..:.....:|:|...|:
Yeast   313 --------------YNIVPF-------TLKQWKEAIASNFLFINGTDSWATTYIENHDQARSI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Amy-dNP_523768.1 AmyAc_bac_euk_AmyA 28..399 CDD:200456 76/412 (18%)
Alpha-amylase 54..342 CDD:278554 62/338 (18%)
Aamy_C 405..493 CDD:214749 6/34 (18%)
MAL12NP_011808.3 AmyAc_SI_OligoGlu_DGase 15..501 CDD:200472 82/453 (18%)
Malt_amylase_C 511..583 CDD:406946
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157342128
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.