DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amy-d and AMY2

DIOPT Version :9

Sequence 1:NP_523768.1 Gene:Amy-d / 36932 FlyBaseID:FBgn0000078 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001323338.1 Gene:AMY2 / 843945 AraportID:AT1G76130 Length:413 Species:Arabidopsis thaliana


Alignment Length:352 Identity:82/352 - (23%)
Similarity:127/352 - (36%) Gaps:97/352 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 HLFEWKWDDIAAECENFLGPNGYAGVQVSPVNENAVKDSRPWWERYQPIS-YKLETRSGNEEQFA 96
            |.::| |.::..:..: :..:|:....:.|.:::...      |.|.|.. |.|.:..|:|....
plant    37 HKYDW-WRNLDGKVPD-IAKSGFTSAWLPPPSQSLAP------EGYLPQDLYSLNSAYGSEHLLK 93

  Fly    97 SMVKRCNAVGVRTYVDVVFNHMAADGGTYGTGGSTASPSSKSYPGVPYSSLDFNPTCAISNYNDA 161
            |::::.....||...|:|.||..  |.|.|.||     ....|.|:   ||.:          |.
plant    94 SLLRKMKQYKVRAMADIVINHRV--GTTRGHGG-----MYNRYDGI---SLPW----------DE 138

  Fly   162 NEVRNCELVGLRDLNQGNSYVQDKVVEFLDHLIDLGVAGFRVDAAKHMWPADLAVIYGRLKNLNT 226
            :.|.:| ..||.:.:.|:::              .||.  .||..:|....|   |.|.|:.|..
plant   139 HAVTSC-TGGLGNRSTGDNF--------------NGVP--NVDHTQHFVRKD---IIGWLRWLRN 183

  Fly   227 DHG-------FASGSKAYIVQEVIDMG------GEAISKSEYTGLGA-ITEFRHS-------DSI 270
            ..|       ||.|..|..|:|.|...      ||......|.|.|. ..:..|.       |:.
plant   184 TVGFQDFRFDFARGYSANYVKEYIGAAKPLFSVGECWDSCNYNGHGLDYNQDSHRQRIISWIDAT 248

  Fly   271 GKV-----FRGKDQLQYLTNWGTAWGFAAS------------DRSLVFVDNHDNQRGHGAGGADV 318
            |::     |..|..||.... |..|....:            .|::.|:||||.       |:..
plant   249 GQISAAFDFTTKGILQEAVK-GQYWRLCDAQGKPPGVMGWWPSRAVTFLDNHDT-------GSTQ 305

  Fly   319 LTYKVPKQYKMAS-AFMLAHPFGTPRV 344
            ..:..|..:.|.. |::|.|| |.|.|
plant   306 AHWPFPSHHVMEGYAYILTHP-GIPCV 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Amy-dNP_523768.1 AmyAc_bac_euk_AmyA 28..399 CDD:200456 82/352 (23%)
Alpha-amylase 54..342 CDD:278554 77/327 (24%)
Aamy_C 405..493 CDD:214749
AMY2NP_001323338.1 PLN02361 15..413 CDD:177990 82/352 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I2673
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D665362at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.