DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amy-d and AMY3

DIOPT Version :9

Sequence 1:NP_523768.1 Gene:Amy-d / 36932 FlyBaseID:FBgn0000078 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_564977.1 Gene:AMY3 / 843319 AraportID:AT1G69830 Length:887 Species:Arabidopsis thaliana


Alignment Length:393 Identity:81/393 - (20%)
Similarity:139/393 - (35%) Gaps:145/393 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 NYASGRSGMVHL-FEWKWDDIAAECENFLGPNGYAGVQVSPVNENAVKDSRPWWERYQPIS-YKL 85
            |:.|.:||..:| .:.|.|::|:        .|:..:.:.|..|:...      |.|.|.. |.|
plant   503 NWESNKSGRWYLELQEKADELAS--------LGFTVLWLPPPTESVSP------EGYMPKDLYNL 553

  Fly    86 ETRSGNEEQFASMVKRCNAVGVRTYVDVVFNHMAAD-----------GGT--------------- 124
            .:|.|..::....||:.:.||::...|.|.||..|.           ||.               
plant   554 NSRYGTIDELKDTVKKFHKVGIKVLGDAVLNHRCAHFKNQNGVWNLFGGRLNWDDRAVVADDPHF 618

  Fly   125 YGTGGSTASPSSKSYPGVPYSSLDFNPTCAISNYNDANEVRNCELVGLRDLNQGNSYVQDKVVEF 189
            .|.|..::..:..:.|.:.:|. ||              ||       :|:.:...::.::|   
plant   619 QGRGNKSSGDNFHAAPNIDHSQ-DF--------------VR-------KDIKEWLCWMMEEV--- 658

  Fly   190 LDHLIDLGVAGFRVDAAKHMWPA--------------------DLAVIYGRLKN----------- 223
                   |..|:|:|..:..|..                    .|:..||.:..           
plant   659 -------GYDGWRLDFVRGFWGGYVKDYMDASKPYFAVGEYWDSLSYTYGEMDYNQDAHRQRIVD 716

  Fly   224 -LNTDHGFASGSKAYIVQEVIDMGGEAISKSEYTGLGAITEFRHSDSIGKVFRGKDQLQYLTNWG 287
             :|...| |:|:.....:.::.   .|:.|.||        :|.||..||.       ..:..| 
plant   717 WINATSG-AAGAFDVTTKGILH---TALQKCEY--------WRLSDPKGKP-------PGVVGW- 761

  Fly   288 TAWGFAASDRSLVFVDNHD--NQRGHGAGGADVLTYKVPKQYKMAS-AFMLAHPFGTPRVMSSFS 349
              |    ..|::.|::|||  :.:||         ::.|:..:|.. |::|.|| |||.|.....
plant   762 --W----PSRAVTFIENHDTGSTQGH---------WRFPEGKEMQGYAYILTHP-GTPAVFFDHI 810

  Fly   350 FTD 352
            |:|
plant   811 FSD 813

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Amy-dNP_523768.1 AmyAc_bac_euk_AmyA 28..399 CDD:200456 79/388 (20%)
Alpha-amylase 54..342 CDD:278554 68/349 (19%)
Aamy_C 405..493 CDD:214749
AMY3NP_564977.1 PLN02784 1..887 CDD:215419 81/393 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D665362at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.