DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amy-d and AMY1

DIOPT Version :9

Sequence 1:NP_523768.1 Gene:Amy-d / 36932 FlyBaseID:FBgn0000078 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_567714.1 Gene:AMY1 / 828603 AraportID:AT4G25000 Length:423 Species:Arabidopsis thaliana


Alignment Length:359 Identity:78/359 - (21%)
Similarity:137/359 - (38%) Gaps:103/359 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 FEWK-W--------------DDIAAECENFLGPNGYAGVQVSPVNENAVKDSRPWWERYQPIS-Y 83
            |.|: |              ||||..        |...:.:.|.:::...      |.|.|.. |
plant    32 FNWESWKKEGGFYNSLHNSIDDIANA--------GITHLWLPPPSQSVAP------EGYLPGKLY 82

  Fly    84 KL-ETRSGNEEQFASMVKRCNAVGVRTYVDVVFNHMAAD------GGTYGTGGSTASPSSKSYPG 141
            .| .::.|:|.:..|::|..|..|::...|:|.||..|:      |..|..||::.         
plant    83 DLNSSKYGSEAELKSLIKALNQKGIKALADIVINHRTAERKDDKCGYCYFEGGTSD--------- 138

  Fly   142 VPYSSLDFNPTCAISN----YNDANEVRNCELVGLRDLNQGNSYVQDKVVEFLDHL-IDLGVAGF 201
               ..||::|:....|    ....|.....:..|..|::..|..||.::.|:::.| .::|..|:
plant   139 ---DRLDWDPSFVCRNDPKFPGTGNLDTGGDFDGAPDIDHLNPRVQKELSEWMNWLKTEIGFHGW 200

  Fly   202 RVDAAKHMWPADLAVIYGRLKNLNTDHGFASGSK--------------------AYIVQEVIDMG 246
            |.|..:. :.:.:..:|.:    ||...||.|.|                    :.:.|.:.:.|
plant   201 RFDYVRG-YASSITKLYVQ----NTSPDFAVGEKWDDMKYGGDGKLDYDQNEHRSGLKQWIEEAG 260

  Fly   247 GEAISKSEYTGLGAITEFRHSDSIGKVFRGKDQLQYLTNWGTAWGFAA--SDRSLVFVDNHDNQR 309
            |..::..::|..|.:    .|...|:::|.||      :.|...|...  ...::.|:||||..|
plant   261 GGVLTAFDFTTKGIL----QSAVKGELWRLKD------SQGKPPGMIGIMPGNAVTFIDNHDTFR 315

  Fly   310 GHGAGGADVLTYKVPK-QYKMASAFMLAHPFGTP 342
                      |:..|. :..:...::|.|| |||
plant   316 ----------TWVFPSDKVLLGYVYILTHP-GTP 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Amy-dNP_523768.1 AmyAc_bac_euk_AmyA 28..399 CDD:200456 78/359 (22%)
Alpha-amylase 54..342 CDD:278554 69/323 (21%)
Aamy_C 405..493 CDD:214749
AMY1NP_567714.1 PLN00196 5..422 CDD:165762 78/359 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 43 1.000 Domainoid score I4741
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I2673
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D665362at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.