DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amy-d and SLC3A1

DIOPT Version :9

Sequence 1:NP_523768.1 Gene:Amy-d / 36932 FlyBaseID:FBgn0000078 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_000332.2 Gene:SLC3A1 / 6519 HGNCID:11025 Length:685 Species:Homo sapiens


Alignment Length:450 Identity:95/450 - (21%)
Similarity:163/450 - (36%) Gaps:128/450 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 VQVSPVNENAVKDSRPWWERYQPISYKLETRSGNEEQFASMVKRCNAVGVRTYVDVVFNHMAADG 122
            |.::...::::||.|...|.::    :::...|..|.|.::|...:..|::..:|.:.|| .:|.
Human   160 VWITSFYKSSLKDFRYGVEDFR----EVDPIFGTMEDFENLVAAIHDKGLKLIIDFIPNH-TSDK 219

  Fly   123 GTY------GTGGST--------ASPSSKSYPGVPYSSLDFNPTCAISNYNDA----NEVRN-CE 168
            ..:      .||..|        ...:.|:.|          |...:|.|.::    :|||| |.
Human   220 HIWFQLSRTRTGKYTDYYIWHDCTHENGKTIP----------PNNWLSVYGNSSWHFDEVRNQCY 274

  Fly   169 ----LVGLRDLNQGNSYVQDKVVEFLDHLIDLGVAGFRVDAAKHMWPA---------------DL 214
                :....|||..|..||:::.|.|...:..||.||.:||.|.:..|               |.
Human   275 FHQFMKEQPDLNFRNPDVQEEIKEILRFWLTKGVDGFSLDAVKFLLEAKHLRDEIQVNKTQIPDT 339

  Fly   215 AVIYGRLKN--LNTDHGFASGSKAYIVQEVID-----------MGGEAISKS-----EYTGLGAI 261
            ...|..|.:  ..|..|.....:::  ::.:|           ||.||.::|     .|.||..|
Human   340 VTQYSELYHDFTTTQVGMHDIVRSF--RQTMDQYSTEPGRYRFMGTEAYAESIDRTVMYYGLPFI 402

  Fly   262 TE----FRHSDSIGKVFRGKDQLQYLTNWGTAWGFAASDRSLVFVDNHDNQRGHG--AGGADV-- 318
            .|    |.:..|:.....|....:.:|:|               ::|....:...  .||.|.  
Human   403 QEADFPFNNYLSMLDTVSGNSVYEVITSW---------------MENMPEGKWPNWMIGGPDSSR 452

  Fly   319 LTYKVPKQYKMASAFMLAHPFGTPRVMSSFSFTDTDQGPPTTDGHNIASPIFNSDNSCSGGWVCE 383
            ||.::..||......:|....|||         .|..|.....|:.:|:.:..|           
Human   453 LTSRLGNQYVNVMNMLLFTLPGTP---------ITYYGEEIGMGNIVAANLNES----------- 497

  Fly   384 HRWRQIYNMVAFRNAVGLDEIQNWWDSGSNQISFSRGSRGFVAFNNDNYDLNSSLQTGLP 443
                  |::...|:...:.     ||:.|| ..||..|..::..|:|.:.:|..:|...|
Human   498 ------YDINTLRSKSPMQ-----WDNSSN-AGFSEASNTWLPTNSDYHTVNVDVQKTQP 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Amy-dNP_523768.1 AmyAc_bac_euk_AmyA 28..399 CDD:200456 83/404 (21%)
Alpha-amylase 54..342 CDD:278554 74/347 (21%)
Aamy_C 405..493 CDD:214749 11/38 (29%)
SLC3A1NP_000332.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56
AmyAc_SLC3A1 116..569 CDD:200494 94/449 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.