DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amy-d and Mal-A8

DIOPT Version :9

Sequence 1:NP_523768.1 Gene:Amy-d / 36932 FlyBaseID:FBgn0000078 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_610384.1 Gene:Mal-A8 / 35830 FlyBaseID:FBgn0033297 Length:588 Species:Drosophila melanogaster


Alignment Length:373 Identity:72/373 - (19%)
Similarity:131/373 - (35%) Gaps:118/373 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SIVCLSLLAVAN--------------------AQFDTNYA-----SGRSGMVHLFEWKWDDIAAE 45
            |::.|.|||:|:                    |||...|.     |...|:..|     :.|.::
  Fly     5 SLLTLLLLAIASNEACQVQSSSSETTKDWWQTAQFYQIYPRSFKDSDGDGIGDL-----NGITSK 64

  Fly    46 CENFLGPNGYAGVQVSPVNENAVKDSRPWWERYQPIS--YKLETRSGNEEQFASMVKRCNAVGVR 108
            .| :|...|.....:||:.::.:.|..      ..||  :.::...|..|.|.:::||...:.::
  Fly    65 LE-YLKDLGVTAAWLSPIFKSPMVDFG------YDISDFFDIQPEYGTLEDFRTLIKRAKELDLK 122

  Fly   109 TYVDVVFNHMA----------------------ADGGTYGTGGSTASPSS--KSYPGVPYSSLDF 149
            ..:|.|.||.:                      .||....|.|....|::  :.:.|..:     
  Fly   123 IVLDFVPNHSSNESEWFLKSVKREKGYEDYYVWHDGKVNSTTGKREPPTNWLQYFRGSAW----- 182

  Fly   150 NPTCAISNYNDANEVR-----NCELVGLRDLNQGNSYVQDKVVEFLDHLIDLGVAGFRVDA---- 205
                      :.||||     :...|...|||..|..|.:::...|.:.::.||:|||.||    
  Fly   183 ----------EWNEVRQQYYLHQFAVQQPDLNYRNPLVVEQMKRVLRYWLNEGVSGFRCDALPPL 237

  Fly   206 ------AKHMWPADLAVIYGRLKNLNTDHGFASGSKAYIVQEVIDMGGEAISKSEYTGLGAITEF 264
                  :...:|.:  |:.|..:: ..|..:.:.:......|.|||               :.::
  Fly   238 FEVVPDSDGQFPDE--VVSGATED-KEDRDYLTTTYIENQPETIDM---------------VYQW 284

  Fly   265 RH-SDSIGKVFRGKDQLQYLTNWGTAWGFAASDRSLVFVDNHDNQRGH 311
            |. .|...::|.|...:..:..:..||      .::.|..|...:..|
  Fly   285 RTVLDDHKRIFGGNSSVLLIETYSPAW------FTMQFYGNRSTEGAH 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Amy-dNP_523768.1 AmyAc_bac_euk_AmyA 28..399 CDD:200456 61/326 (19%)
Alpha-amylase 54..342 CDD:278554 56/300 (19%)
Aamy_C 405..493 CDD:214749
Mal-A8NP_610384.1 AmyAc_maltase 30..506 CDD:200467 66/348 (19%)
trehalose_treC 33..585 CDD:274115 66/345 (19%)
Malt_amylase_C 487..585 CDD:295440
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443602
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.