DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amy-d and Mal-A5

DIOPT Version :9

Sequence 1:NP_523768.1 Gene:Amy-d / 36932 FlyBaseID:FBgn0000078 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_610382.2 Gene:Mal-A5 / 35828 FlyBaseID:FBgn0050359 Length:630 Species:Drosophila melanogaster


Alignment Length:335 Identity:73/335 - (21%)
Similarity:114/335 - (34%) Gaps:95/335 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 GNEEQFASMVKRCNAVGVRTYVDVVFNHMAADGGTYGTGGSTASPSSKSY----PGVPYSSLDFN 150
            |....|..:::....:.::..:|.|.|| ::|...:....:...|..|.:    ||...:.....
  Fly   115 GTMADFEHLMEVAKKLDIKIILDFVPNH-SSDECEWFRRSAARDPEFKDFYVWHPGRMENGNRHP 178

  Fly   151 PTCAISNYNDA--------NEVRNCELVGLR-DLNQGNSYVQDKVVEFLDHLIDLGVAGFRVDAA 206
            |:..||.:..:        .|....:.|..: |||..|..|::.:...|...:..||||||:||.
  Fly   179 PSNWISVFRGSAWQWHEGRQEFYLHQFVKKQPDLNYRNPKVRETMSNVLRFWLGKGVAGFRIDAV 243

  Fly   207 KHM------------------W---PADLAVIYGRLKNLNTDHGFASGSKAYIVQEVIDM----- 245
            .|:                  |   |.|    ||.|:::.|.....:....|..:.|:|.     
  Fly   244 PHVFEIAPDNQNQYRDEPRNDWDNDPED----YGYLQHIYTKDQPETIDLVYSWRAVLDAHQREH 304

  Fly   246 GGE--AISKSEY-------------TGLGA--------ITEFRHSDSI----GKVFRGKDQLQYL 283
            |||  .:....|             |..||        |:|..:|.:.    |.|.:   .||::
  Fly   305 GGEDRILMAETYSPIDIVMQYYGNATAEGAQLPFNFLLISELSNSSNAHAYEGTVLK---WLQHM 366

  Fly   284 TNWGTA-WGFAASDRSLVFVDNHDNQRGHGAGGAD------VLTYKVPKQYKMASAFMLAHPFGT 341
            ....|| |          .:.|||..|.....|.|      :||..:|.    ||........|.
  Fly   367 PKGRTANW----------VLGNHDQPRVGSRLGRDRVDMLNMLTATLPG----ASVTYQGEELGM 417

  Fly   342 PRVMSSFSFT 351
            ..|..|:..|
  Fly   418 TNVWISWKDT 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Amy-dNP_523768.1 AmyAc_bac_euk_AmyA 28..399 CDD:200456 73/335 (22%)
Alpha-amylase 54..342 CDD:278554 70/324 (22%)
Aamy_C 405..493 CDD:214749
Mal-A5NP_610382.2 AmyAc_maltase 41..514 CDD:200467 73/335 (22%)
Alpha-amylase 67..421 CDD:278554 70/327 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443622
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.