DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amy-d and Mal-B1

DIOPT Version :9

Sequence 1:NP_523768.1 Gene:Amy-d / 36932 FlyBaseID:FBgn0000078 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_609522.1 Gene:Mal-B1 / 34597 FlyBaseID:FBgn0032381 Length:584 Species:Drosophila melanogaster


Alignment Length:483 Identity:90/483 - (18%)
Similarity:149/483 - (30%) Gaps:188/483 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 GYAGVQVSPVNENAVKDSRPWWERYQPISY-KLETRSGNEEQFASMVKRCNAVGVRTYVDVVFNH 117
            |...|.:||:.|:.:.|.     .|...:| .::...|..|.|.:::.:.|.:||:..:|.|.||
  Fly    72 GITSVWLSPIYESPMVDF-----GYDISNYTNIQPEYGTLEDFDALIAKANELGVKVILDFVPNH 131

  Fly   118 MAADGGTYGTGGSTASP----SSKSYPGVPYSSLDF---------------NPTCAISNYNDANE 163
                       .|...|    |....||..    ||               .|...:|.::.:..
  Fly   132 -----------SSNKHPWFIKSVAREPGYE----DFYVWEDGILLENGTRVPPNNWLSVFSGSAW 181

  Fly   164 VRNCE---------LVGLRDLNQGNSYVQDKVVEFLDHLIDLGVAGFRVDAAKHMW--------- 210
            :.|.|         ..|..|||..|..|...:.:.:...::.|:||||:||..:::         
  Fly   182 MWNDERQQYYLRQFTYGQPDLNYRNPAVIKAMDDVMLFWLNKGIAGFRIDAIIYIYEDAQLRDEP 246

  Fly   211 ----------PADLAVIYGR---------------LKNLNTDH----------GFASGSKAYIVQ 240
                      .|.|:.||.|               |.|...:|          |:||.|:  :::
  Fly   247 PSGTTDDPNNEAYLSHIYTRNQPEDYGLLQHWRQLLDNYTANHDGPLRIMMTEGYASVSQ--LME 309

  Fly   241 EVIDMGGEAISKSEYT-GLGAITEFRHSDSIGKVFRGKDQLQYLTNWGTAWGFAASDRSLVF--- 301
            ...|..|  :...::. ....|||...:.:      ..|.:.|::.|            |::   
  Fly   310 YYEDSNG--VQGPQFPFNFDFITELNANST------AADFVFYISRW------------LIYMPH 354

  Fly   302 -------VDNHDNQRGHGAGGADVLTYKVPKQYKMASAFMLAHPFGTPRVMSSFSFTDTDQGPPT 359
                   :.||||                                  |||.|.|       |..:
  Fly   355 GHVANWVMGNHDN----------------------------------PRVASRF-------GEKS 378

  Fly   360 TDGHNIASPIFNSDNSCSGGWVCEHRWRQIYNMVAFRNAV-------GLDEIQN----------W 407
            .|..|:.............|   |......|..:::.:.|       |:|..:.          .
  Fly   379 VDAMNMLLMTLPGIGITYNG---EELGMTDYRDISWSDTVDQPACEAGIDNYKTISRDPERTPMQ 440

  Fly   408 WDSGSNQISFSRGSRGFVAFNNDNYDLN 435
            |.|..| ..||...|.::..|.:..:||
  Fly   441 WSSDVN-AGFSSADRTWLPVNPNYKELN 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Amy-dNP_523768.1 AmyAc_bac_euk_AmyA 28..399 CDD:200456 78/428 (18%)
Alpha-amylase 54..342 CDD:278554 67/371 (18%)
Aamy_C 405..493 CDD:214749 9/41 (22%)
Mal-B1NP_609522.1 AmyAc_maltase 30..500 CDD:200467 90/483 (19%)
trehalose_treC 33..538 CDD:274115 90/483 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443605
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.