DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amy-d and Slc3a2

DIOPT Version :9

Sequence 1:NP_523768.1 Gene:Amy-d / 36932 FlyBaseID:FBgn0000078 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001154885.1 Gene:Slc3a2 / 17254 MGIID:96955 Length:565 Species:Mus musculus


Alignment Length:261 Identity:45/261 - (17%)
Similarity:88/261 - (33%) Gaps:93/261 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 QVSPVNENAVKDSRPWWERYQPISYKLETRSGNEEQFASMVKRCNAVGVRTYVDVVFNHMAADGG 123
            |...:||..:|...|              ..|::|.|..:::......:...:|:..|:...:..
Mouse   200 QKDEINETDLKQINP--------------TLGSQEDFKDLLQSAKKKSIHIILDLTPNYQGQNAW 250

  Fly   124 TYGTGGSTASPSSKSYPGVPYSSLDFNPTCAISNYNDANEVRNCELVGLRDLNQGNSYVQDKVVE 188
                                     |.|..|             ::|..:.....:|::||    
Mouse   251 -------------------------FLPAQA-------------DIVATKMKEALSSWLQD---- 273

  Fly   189 FLDHLIDLGVAGFRV-DAAKHM-WPADLAVIYGRLKNLNTDHGFASGSKAYIVQEVID------- 244
                    ||.||:. |..|.| .|..||......|||:.|....:|:::..:|::::       
Mouse   274 --------GVDGFQFRDVGKLMNAPLYLAEWQNITKNLSEDRLLIAGTESSDLQQIVNILESTSD 330

  Fly   245 --MGGEAISKSEYTGLGAITEFRHSDSIGKVFRGKDQLQYLTNWGTAW-GFAASDRSLV--FVDN 304
              :....:|.|.:||       ..::|:        ..::|...|:.| .::.|...|:  |:.:
Mouse   331 LLLTSSYLSNSTFTG-------ERTESL--------VTRFLNATGSQWCSWSVSQAGLLADFIPD 380

  Fly   305 H 305
            |
Mouse   381 H 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Amy-dNP_523768.1 AmyAc_bac_euk_AmyA 28..399 CDD:200456 45/261 (17%)
Alpha-amylase 54..342 CDD:278554 45/261 (17%)
Aamy_C 405..493 CDD:214749
Slc3a2NP_001154885.1 SLC3A2_N 85..156 CDD:292647
AmyAc_family 139..468 CDD:298606 45/261 (17%)
AmyA 169..513 CDD:223443 45/261 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.