DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Amy-d and si:dkey-202g17.3

DIOPT Version :9

Sequence 1:	NP_523768.1	Gene:	Amy-d / 36932	FlyBaseID:	FBgn0000078	Length:	494	Species:	Drosophila melanogaster
Sequence 2:	XP_001343266.1	Gene:	si:dkey-202g17.3 / 100003805	ZFINID:	ZDB-GENE-131127-371	Length:	487	Species:	Danio rerio

Alignment Length:	93	Identity:	16/93 - (17%)
Similarity:	28/93 - (30%)	Gaps:	32/93 - (34%)

- Green bases have known domain annotations that are detailed below.

  Fly   345 MSSFSFTDTDQG-----------PPTTDGHNIASPIFNSD-NSCSGG--------------WVCE 383
            :|...|||.:..           ||.........|:...: ..|:||              |:|
Zfish    14 VSGARFTDVEGSESVPLLTPGPPPPPPARRRAWKPLSREELERCAGGPQWRKFRRRLVLCFWIC- 77

  Fly   384 HRWRQIYN---MVAFRNAVGLDEIQNWW 408
              |..:..   ::..|:......:.:||
Zfish    78 --WMLLLGAAVLIVIRSPRATSPVLHWW 103

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Amy-d	NP_523768.1	AmyAc_bac_euk_AmyA	28..399	CDD:200456	14/82 (17%)
		Alpha-amylase	54..342	CDD:278554
		Aamy_C	405..493	CDD:214749	2/4 (50%)
si:dkey-202g17.3	XP_001343266.1	SLC3A2_N	49..105	CDD:292647	9/58 (16%)
		AmyAc_family	93..404	CDD:298606	2/11 (18%)
		Alpha-amylase	132..362	CDD:278554
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C170576486
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0366
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	1.830