DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and SERPINB11

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001357404.1 Gene:SERPINB11 / 89778 HGNCID:14221 Length:392 Species:Homo sapiens


Alignment Length:376 Identity:81/376 - (21%)
Similarity:157/376 - (41%) Gaps:46/376 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 NIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGTHLSEYKPKTQKIFAMSVKKAPVAKSLTR 102
            ||.||:..:..::..:.:|...:..||:.|.:|:..| :...||.    |..|.|.:...:..:.
Human    27 NIFFSSLSLLYALSMVLLGARGETEEQLEKVLHFSHT-VDSLKPG----FKDSPKCSQAGRIHSE 86

  Fly   103 FYVR--------QNMKMSTEYRVFMRHT---------------EGRARNIAFAREQLDE-----V 139
            |.|.        .|..:|...|::...|               :.|.:.:.|  ||..|     :
Human    87 FGVEFSQINQPDSNCTLSIANRLYGTKTMAFHQQYLSCSEKWYQARLQTVDF--EQSTEETRKTI 149

  Fly   140 NTFYSHEMGEQIGQVVKESWWKPNSQGLLVNAIFFNLSWERTFNPEATYPREFRVNATKSVMIPM 204
            |.:..::...::..:..:|...|:|..:|||||:|...|:..|....|....|:::..|:|.:.|
Human   150 NAWVENKTNGKVANLFGKSTIDPSSVMVLVNAIYFKGQWQNKFQVRETVKSPFQLSEGKNVTVEM 214

  Fly   205 MHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPDQPDGLAAL-----QMKLQAMNILSVARN 264
            |::...|....:...:...:.:|:.:..|.|:::   .|.|:|.|     |:.....:..:.:.|
Human   215 MYQIGTFKLAFVKEPQMQVLELPYVNNKLSMIIL---LPVGIANLKQIEKQLNSGTFHEWTSSSN 276

  Fly   265 LTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVIHVVTFEFQE 329
            :...:|.|.:|:||:.:..||:...:.:|:.|:|...|:..:.:.......:...||....:..|
Human   277 MMEREVEVHLPRFKLETKYELNSLLKSLGVTDLFNQVKADLSGMSPTKGLYLSKAIHKSYLDVSE 341

  Fly   330 QGIGTPSTDVGNGSLTHTFNGVKYFLATHPFAFYI--IDNTSIYFAGHVTS 378
            :|....:. .|:.....:......|.|.|||.|:|  ....:|.|.|.:.|
Human   342 EGTEAAAA-TGDSIAVKSLPMRAQFKANHPFLFFIRHTHTNTILFCGKLAS 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 80/372 (22%)
SERPINB11NP_001357404.1 ovalbumin_like 4..392 CDD:239014 81/376 (22%)
RCL. /evidence=ECO:0000250 341..365 3/24 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.