DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and SERPINB7

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001035237.1 Gene:SERPINB7 / 8710 HGNCID:13902 Length:380 Species:Homo sapiens


Alignment Length:389 Identity:91/389 - (23%)
Similarity:168/389 - (43%) Gaps:42/389 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AQKNSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMH------YRGT 74
            |..|::....|:..:.::..|.|:.||:..:.:::..:.:|.::|...||.|.:|      |..:
Human     5 AAANAEFCFNLFREMDDNQGNGNVFFSSLSLFAALALVRLGAQDDSLSQIDKLLHVNTASGYGNS 69

  Fly    75 HLSEYKPKTQ------------KIFAMSVKKAPVAKSLTRF---YVRQNMKM---STEYRVFMRH 121
            ..|:...::|            |.:.:|:.....|:.:..|   |:....|:   ..|...|..|
Human    70 SNSQSGLQSQLKRVFSDINASHKDYDLSIVNGLFAEKVYGFHKDYIECAEKLYDAKVERVDFTNH 134

  Fly   122 TEGRARNIAFAREQLDEVNTFYSHEMGEQIGQVVKESWWKPNSQGLLVNAIFFNLSWERTFNPEA 186
            .|...|||          |.:..:|...:|..|:.|.....::..:||||::|...|:..|....
Human   135 LEDTRRNI----------NKWVENETHGKIKNVIGEGGISSSAVMVLVNAVYFKGKWQSAFTKSE 189

  Fly   187 TYPREFRVNATKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPDQPDGLAALQM 251
            |....|:........:.|||::.||...::.: .:..:|....:|.:.|.::.|:  :.|:.::.
Human   190 TINCHFKSPKCSGKAVAMMHQERKFNLSVIED-PSMKILELRYNGGINMYVLLPE--NDLSEIEN 251

  Fly   252 KLQAMNIL--SVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNF 314
            ||...|::  :..|.:|...|.|..|:|||..:.|:......:|:||||..||:..:.:......
Human   252 KLTFQNLMEWTNPRRMTSKYVEVFFPQFKIEKNYEMKQYLRALGLKDIFDESKADLSGIASGGRL 316

  Fly   315 RIDGVIHVVTFEFQEQGI-GTPSTDVGNGSLTHTFNGVKYFLATHPFAFYIIDNTSIYFAGHVT 377
            .|..::|....|..|:|. .|.:|  |:..:.........|.|.|||.|.|..:..|.|:|.|:
Human   317 YISRMMHKSYIEVTEEGTEATAAT--GSNIVEKQLPQSTLFRADHPFLFVIRKDDIILFSGKVS 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 88/377 (23%)
SERPINB7NP_001035237.1 serpinB7_megsin 1..380 CDD:381032 91/389 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.