DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and SERPINH1

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001193943.1 Gene:SERPINH1 / 871 HGNCID:1546 Length:418 Species:Homo sapiens


Alignment Length:377 Identity:77/377 - (20%)
Similarity:152/377 - (40%) Gaps:30/377 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AQKNSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGTHLSEYK 80
            |::::.|...||.|:....:..||:.|..::.||:..:.:|.:...:.|.:..       ||..:
Human    44 AERSAGLAFSLYQAMAKDQAVENILVSPVVVASSLGLVSLGGKATTASQAKAV-------LSAEQ 101

  Fly    81 PKTQKIFA------MSVKKAPVAKSLT-----RFYVRQNMKMSTEY-RVFMRHTEGRARNIAF-- 131
            .:.:::.|      .|:..: .|:::|     |.|...::..:.:: |...:|.......|.|  
Human   102 LRDEEVHAGLGELLRSLSNS-TARNVTWKLGSRLYGPSSVSFADDFVRSSKQHYNCEHSKINFRD 165

  Fly   132 AREQLDEVNTFYSHEMGEQIGQVVKESWWKPNSQGLLVNAIFFNLSWERTFNPEATYPREFRVNA 196
            .|..|..:|.:.:.....::.:|.|:.  :.....|||||:||...|:..|:.:....|.|.|..
Human   166 KRSALQSINEWAAQTTDGKLPEVTKDV--ERTDGALLVNAMFFKPHWDEKFHHKMVDNRGFMVTR 228

  Fly   197 TKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPDQPDGLAALQMKLQAMNILSV 261
            :.:|.:.|||....:.:......|...|.:|.:|....::::.|...:.|..|:..|....:...
Human   229 SYTVGVMMMHRTGLYNYYDDEKEKLQIVEMPLAHKLSSLIILMPHHVEPLERLEKLLTKEQLKIW 293

  Fly   262 ARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVIHVVTFE 326
            ...:....|.:.:||..:....:|......:|:.:....:|:..:.:....:..:..|.|...||
Human   294 MGKMQKKAVAISLPKGVVEVTHDLQKHLAGLGLTEAIDKNKADLSRMSGKKDLYLASVFHATAFE 358

  Fly   327 FQEQGIGTPSTDVGNGSLTHTFNGVKYFLATHPFAFYIID--NTSIYFAGHV 376
            ....|........|...|    ...|.|.|.|||.|.:.|  :.|:.|.|.:
Human   359 LDTDGNPFDQDIYGREEL----RSPKLFYADHPFIFLVRDTQSGSLLFIGRL 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 75/366 (20%)
SERPINH1NP_001193943.1 serpinH1_CBP1 36..417 CDD:381003 77/377 (20%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 415..418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.