DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and SRP3

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_176586.1 Gene:SRP3 / 842706 AraportID:AT1G64030 Length:385 Species:Arabidopsis thaliana


Alignment Length:373 Identity:80/373 - (21%)
Similarity:143/373 - (38%) Gaps:68/373 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 NIMFSTEMIRSSMLFIYVGVEED-ESEQIRKAMHYRGTHLSEYKPKTQKIFAM-----SVKKAPV 96
            |::||...|.|::.....|...| .|.||...:  |.:.:.|.|...:::.::     |....|.
plant    30 NVIFSPASINSAITMHAAGPGGDLVSGQILSFL--RSSSIDELKTVFRELASVVYADRSATGGPK 92

  Fly    97 AKSLTRFYVRQNMKMSTEYR-VFMRHTEGRARNIAF---AREQLDEVNTFYSHEMGEQIGQVVKE 157
            ..:....::.:::....::: :|....:.....:.|   |.|...|||::..|.....|..::.:
plant    93 ITAANGLWIDKSLPTDPKFKDLFENFFKAVYVPVDFRSEAEEVRKEVNSWVEHHTNNLIKDLLPD 157

  Fly   158 SWWKPNSQGLLVNAIFFNLSWERTFNPEATYPRE---FRVNATKSVMIPMMHE-DSKF-----AF 213
            ......:..:..||:.|..:|:|.|  |..|.|:   :.||.| ||.:|.|.. ::::     .|
plant   158 GSVTSLTNKIYANALSFKGAWKRPF--EKYYTRDNDFYLVNGT-SVSVPFMSSYENQYVRAYDGF 219

  Fly   214 GILGNLKATAVLVPFSHGD------LRMLLIKPDQPDGLAALQMKLQAMNILSVARNLTMMDVF- 271
            .:|        .:|:..|.      ..|....||:.|||..|..|:.:......:...|..|.. 
plant   220 KVL--------RLPYQRGSDDTNRKFSMYFYLPDKKDGLDDLLEKMASTPGFLDSHIPTYRDELE 276

  Fly   272 -VGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVIHVVTFEFQEQG---- 331
             ..||||||.....::...:::|::.:                    .:.|....|..|:|    
plant   277 KFRIPKFKIEFGFSVTSVLDRLGLRSM--------------------SMYHKACVEIDEEGAEAA 321

  Fly   332 IGTPSTDVGNGSLTHTFNGVKY-FLATHPFAFYIIDNT--SIYFAGHV 376
            ..|...|.| .||.......|. |:|.|||.|.|.:..  ::.|.|.:
plant   322 AATADGDCG-CSLDFVEPPKKIDFVADHPFLFLIREEKTGTVLFVGQI 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 80/371 (22%)
SRP3NP_176586.1 serpinP_plants 8..371 CDD:381001 80/373 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.