DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and AT2G35580

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_181101.1 Gene:AT2G35580 / 818123 AraportID:AT2G35580 Length:374 Species:Arabidopsis thaliana


Alignment Length:344 Identity:68/344 - (19%)
Similarity:120/344 - (34%) Gaps:91/344 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 TQKIFAMS------------VKKAPVAKSLTRFYVRQNMKMSTEYRVFMRHTEGRARNIAFAREQ 135
            |.|:.|:|            ....|...:....::.:.:.:...::..:.::...|.|....|.:
plant    66 TDKLHAVSSEIVTTVLADSTASGGPTISAANGLWIEKTLNVEPSFKDLLLNSYKAAFNRVDFRTK 130

  Fly   136 LDEVNTFYSHEMGEQIGQVVKESWWKPNSQGLL------------------VNAIFFNLSWERTF 182
            .||||    .|:         .||.:..:.||:                  .||:|||..|:..|
plant   131 ADEVN----REV---------NSWVEKQTNGLITNLLPSNPKSAPLTDHIFANALFFNGRWDSQF 182

  Fly   183 NPEATYPREFRVNATKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLR---MLLIKPDQPD 244
            :|..|...:|.:.....|.:|.|...|.....:....|...:.......|.|   |.:..||:.|
plant   183 DPSLTKDSDFHLLDGTKVRVPFMTGASCRYTHVYEGFKVINLQYRRGREDSRSFSMQIYLPDEKD 247

  Fly   245 GLAALQMKLQAM------NILSVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKS 303
            ||.::..:|.:.      |.:..:.:..:.:  :.||:||.....|.|.|.:..|:      ...
plant   248 GLPSMLERLASTRGFLKDNEVLPSHSAVIKE--LKIPRFKFDFAFEASEALKGFGL------VVP 304

  Fly   304 FSTLLHRNTNFRIDGVIHVVTFEFQEQGIGTPSTDVGNGSLTHTFNGV--------KY-FLATHP 359
            .|.::|::            ..|..|.|        ...:....|.|:        |: |:|.||
plant   305 LSMIMHKS------------CIEVDEVG--------SKAAAAAAFRGIGCRRPPPEKHDFVADHP 349

  Fly   360 FAFYIIDNTS--IYFAGHV 376
            |.|.:.:..|  :.|.|.|
plant   350 FLFIVKEYRSGLVLFLGQV 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 67/342 (20%)
AT2G35580NP_181101.1 plant_SERPIN 8..371 CDD:238998 68/344 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.