DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpind1

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_077358.1 Gene:Serpind1 / 79224 RGDID:619854 Length:479 Species:Rattus norvegicus


Alignment Length:403 Identity:85/403 - (21%)
Similarity:168/403 - (41%) Gaps:48/403 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLILLGISRYRAQK--NSQLPDELYAAIVN-SFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQI 65
            :|.:..|.||.:...  |::....||..:.: :.|:.||..:...|.::|..|.:|:..:..|::
  Rat    93 ILQLFQGKSRIQRLNILNAKFAFNLYRVLKDQATSSDNIFIAPVGISTAMGMISLGLRGETHEEV 157

  Fly    66 RKAMHYRG-----------THLSEYKPKTQKIFAMSVKKAPVAKSLTRFYVRQNMKMSTEYRVFM 119
            ...:|::.           |..:.::..|.::|..:.  ....:|:...|:::...:..:::..|
  Rat   158 HSVLHFKDFVNASSKYEVTTIHNLFRKLTHRLFRRNF--GYTLQSVNDLYIQKQFPIREDFKAAM 220

  Fly   120 RHTEGRARNIAFAREQ---------LDEVNTFYSHEMGEQIGQVVKESWWKPNS--QGLLVNAIF 173
                   |...||..|         :.:.|   ||.:....| ::||:....:|  |.:::|.|:
  Rat   221 -------REFYFAEAQEADFSDPAFISKAN---SHILKLTKG-LIKEALENTDSATQMMILNCIY 274

  Fly   174 FNLSWERTFNPEATYPREFRVNATKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLI 238
            |..:|...|..|.|:...||:|..:.|.:.||.....|.......|....:.:.:. |.:.||::
  Rat   275 FKGAWMNKFPVEMTHNHNFRLNEREVVKVSMMQTKGNFLAANDQELDCDILQLEYV-GGISMLIV 338

  Fly   239 KPDQPDGLAALQMKLQAMNILSVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKS 303
            .|.:..|:..|:.:|....:....:::|.....|.:||||:..:..|....:.|||..:|..:.:
  Rat   339 IPRKLSGMKTLEAQLTPQVVERWQKSMTNRTREVLLPKFKLEKNYNLVEVLKSMGITKLFNKNGN 403

  Fly   304 FSTLLHRNTNFRIDGVIHVVTFEFQEQGIGTPS-TDVGNGSLTHTFNGVKYFLATHPFAFYIIDN 367
            .|.:  .:....||...|..|....|:|....: |.||...|:....    |....||.|.:.::
  Rat   404 MSGI--SDQRIIIDLFKHQSTITVNEEGTQAAAVTTVGFMPLSTQVR----FTVDRPFLFLVYEH 462

  Fly   368 --TSIYFAGHVTS 378
              :.:.|.|.|.:
  Rat   463 RTSCLLFMGRVAN 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 79/376 (21%)
Serpind1NP_077358.1 HCII 44..477 CDD:239002 85/403 (21%)
2 X 11 AA approximate repeats, Asp/Glu-rich (acidic) (hirudin-like) 55..79
Glycosaminoglycan-binding site. /evidence=ECO:0000250 172..192 3/19 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.