DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpine3

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:XP_006252257.2 Gene:Serpine3 / 691375 RGDID:1585042 Length:413 Species:Rattus norvegicus


Alignment Length:389 Identity:76/389 - (19%)
Similarity:140/389 - (35%) Gaps:61/389 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGTHLSEYKPKTQKIFAMS 90
            ||.:.....:..|.:.|...:..|:..:......:...|:.:|:.|                  :
  Rat    39 LYQSAAAETNGTNFVISPASVSLSLEILQFAARGNTGWQLAEALGY------------------T 85

  Fly    91 VKKAPVAKSLTRFYV-----RQNMKMSTEYRVFMR----------HTEGRARNIAFAREQLDEVN 140
            |:...|.:.|...|:     .|.:.|.....:||:          ....|..|.:.......|.|
  Rat    86 VQDPRVREFLHTVYITLHNSSQGIGMELACTLFMQTGTSLSPCFVEQVSRWANSSLELADFSEPN 150

  Fly   141 TFYSH--------EMGEQIGQVVKESWWKP---NSQGLLVNAIFFNLSWERTFNPEATYPREFRV 194
            |....        ..||..|..:   |.:.   ::|..:|:.:.|..||::.|:..|..|..|..
  Rat   151 TTTMEASKGTTRPSTGEGPGSPL---WGRAGALSTQLSIVSTMTFQSSWQQRFSSVALQPLPFTC 212

  Fly   195 NATKSVMIPMMHEDSKFAFG----ILGNLKATAVLVPFSHGDLRMLLIKPDQPDGLAALQMKLQA 255
            .....:.:|.||:.::.::|    ..|:......|:........:|::..|:...|..::..|.|
  Rat   213 AHGLVLQVPAMHQVAEVSYGQFQDAAGHKVDVLELLYLGRVASLLLVLPQDKGTPLDHIEPHLTA 277

  Fly   256 --MNILSVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDG 318
              :::.:.......||||  :|:|:|.:..:|.......||.|:|.|.|:....:.....|.:..
  Rat   278 RVIHLWTTRLKRARMDVF--LPRFRIQNQFDLKSILRSWGITDLFDPLKANLKGISGRDGFYVSE 340

  Fly   319 VIHVVTFEFQEQGIGTPSTDVGNGSLTHTFNGVKYFLATHPFAFYIIDNTSIYFA---GHVTSF 379
            |.|....|..|:  ||.|. .....|....:....|.|..||.|.:.::.::...   |.|.:|
  Rat   341 VTHKAKMELSEE--GTKSC-AATAVLLLRRSRTPAFKADRPFIFLLREHNTVAVRITHGKVANF 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 74/384 (19%)
Serpine3XP_006252257.2 serpin 20..400 CDD:422956 75/386 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.