DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and SERPINA7

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:XP_006724746.1 Gene:SERPINA7 / 6906 HGNCID:11583 Length:425 Species:Homo sapiens


Alignment Length:411 Identity:99/411 - (24%)
Similarity:164/411 - (39%) Gaps:86/411 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGT--------- 74
            |:.....||........::||.||...|.::::.:..|.......:|.:.:.:..|         
Human    46 NADFAFNLYRRFTVETPDKNIFFSPVSISAALVMLSFGACCSTQTEIVETLGFNLTDTPMVEIQH 110

  Fly    75 ---HL--SEYKPKTQKIFAMSVKKA--------PVAKSLTRFYVRQNMKMSTEYRVFMRHTEGRA 126
               ||  |...||  |...:.:..|        |:||.|      .::|...|..||.....   
Human   111 GFQHLICSLNFPK--KELELQIGNALFIGKHLKPLAKFL------NDVKTLYETEVFSTDFS--- 164

  Fly   127 RNIAFAREQLDEVNTFYSH-EM---GEQIGQVVKESWWKPNSQGLLVNAIFFNLSWERTFNPEAT 187
             ||:.|:::::      || ||   |:.:|.:..   .|||:..:|||.|.|...|...|:|..|
Human   165 -NISAAKQEIN------SHVEMQTKGKVVGLIQD---LKPNTIMVLVNYIHFKAQWANPFDPSKT 219

  Fly   188 Y-PREFRVNATKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLI-KPDQPDGL-AAL 249
            . ...|.::.|.:|.:||||:..::...:...|..|.:.:.:|...|.:.:: |..|.:.: ||:
Human   220 EDSSSFLIDKTTTVQVPMMHQMEQYYHLVDMELNCTVLQMDYSKNALALFVLPKEGQMESVEAAM 284

  Fly   250 QMK-LQAMNILSVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRN-- 311
            ..| |:..|.|   .....:|:||  |||.|.:..:|.....||||:..:..:..||.|...|  
Human   285 SSKTLKKWNRL---LQKGWVDLFV--PKFSISATYDLGATLLKMGIQHAYSENADFSGLTEDNGL 344

  Fly   312 -TNFRIDGVI------HVVTFEFQEQG---IGTPSTDVGNGSLTHTFNGVKYFLATHP------- 359
             .:.|..|.:      |.......|:|   ...|..::.: ...:||        .||       
Human   345 KLSNRPAGFVLPTQAAHKAVLHIGEKGTEAAAVPEVELSD-QPENTF--------LHPIIQIDRS 400

  Fly   360 FAFYIIDNT--SIYFAGHVTS 378
            |...|::.:  ||.|.|.|.:
Human   401 FMLLILERSTRSILFLGKVVN 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 97/401 (24%)
SERPINA7XP_006724746.1 alpha-1-antitrypsin_like 46..419 CDD:239011 98/407 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.