DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpina1f

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_080963.2 Gene:Serpina1f / 68348 MGIID:1915598 Length:411 Species:Mus musculus


Alignment Length:423 Identity:78/423 - (18%)
Similarity:167/423 - (39%) Gaps:71/423 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLLLI----LLGISRYRAQKNSQLPD------------------ELYAAIVNSFSNRNIMFSTEM 45
            :|||:    ||.|::.:.:|..:.|.                  .|:..:.....|.||:||...
Mouse    10 LLLLVGLCCLLLITKTKHEKLYEDPSIDPFQCRKVALTICNVSITLFKKMAQLSGNGNILFSPIR 74

  Fly    46 IRSSMLFIYVGVEEDESEQIRKAMHYRGTHLSEYKPKTQKIF---AMSVKKAPVAKSL---TRFY 104
            :.:::..:.:|...:.|:.|.:.:.:..|.|.|  .:..|.|   ..|:.:.....||   :..:
Mouse    75 VIAAISMLSLGSNGNLSKHILETLRFNKTGLPE--AEIHKCFWYLLHSIHQTEEPSSLQTGSSVF 137

  Fly   105 VRQNMKMSTEYRVFMR------HTEGRARNIAFAREQLDEVNTFYSHEMGEQIGQVVKESWWKPN 163
            :.|::   |....|::      |::..:.|...:.:...::|.:...:..::|..:||.  .:.:
Mouse   138 IHQDL---TSVDKFVKGVKDLYHSDMISINFTDSSQAKTQINNYVMEKSQKEIVNIVKN--LESD 197

  Fly   164 SQGLLVNAIFFNLSWERTFNPEATYPREFRVNATKSVMIPMMHEDSKFAFGILGNLKATAVLVPF 228
            :...:||.|.:|...:..|...:...:::.:....::.:||:|..:......:.:|.:|.:::..
Mouse   198 TFLAVVNYIIWNAKLDSNFGCRSVKVKDYHLGYGMTIKVPMIHNMAMHYLFRVEDLSSTVLMLTL 262

  Fly   229 SHGDLRMLLIKPDQPDGLAALQMKLQAMNILSVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMG 293
            ..|:.....|.|| |..:..::..|...:...:.|.|....|.:.||:..:....:|......:|
Mouse   263 LTGNFATYFIIPD-PGKMQKVEQSLTYPHFRRMRRQLLTRLVDLEIPELSLSETHDLESMMSLLG 326

  Fly   294 IKDIFKPSKSFSTLLHRNTNFRIDGVIHVVTFEFQEQG-----------IGTPSTDVGNGSLTHT 347
            |..:|....:.|.:  .:|..:...|:........|:|           :|  |||:|...|   
Mouse   327 ITYVFNSGTNSSDM--NDTLQKSFKVVSKAVLTIDEKGSKPSTNSCFKKLG--STDMGRMQL--- 384

  Fly   348 FNGVKYFLATHPFAFYIIDNTS--IYFAGHVTS 378
                     ..||..:|.|:|:  ..|.|.|.:
Mouse   385 ---------NRPFLIFIQDHTNDVPLFLGRVVN 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 69/375 (18%)
Serpina1fNP_080963.2 Serpin 48..409 CDD:278507 70/385 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.