DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpina12

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_080811.1 Gene:Serpina12 / 68054 MGIID:1915304 Length:413 Species:Mus musculus


Alignment Length:401 Identity:84/401 - (20%)
Similarity:158/401 - (39%) Gaps:73/401 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SRYRAQKNSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRK--------- 67
            :|..|:.|.:...:|...:.::....||..|...|.::...:.:|.:....|:||:         
Mouse    45 ARQLARHNMEFGFKLLQRLASNSPQGNIFLSPLSISTAFSMLSLGAQNSTLEEIREGFNFKEMSN 109

  Fly    68 -----AMHYRGTHLSEYKPKTQ----KIFAMSVKKAP------VAKS-------LTRFYVRQNMK 110
                 |.||....|::....|:    ....|..|..|      :||:       ||.|...:|.:
Mouse   110 WDVHAAFHYLLHKLNQETEDTKMNLGNALFMDQKLRPQQRFLNLAKNVYDADMVLTNFQDLENTQ 174

  Fly   111 MSTEYRVFMRHTEGRARNIAFAREQLDEVNTFYSHEMGEQIGQVVKESWWKPNSQGLLVNAIFFN 175
                                      .::|.:.|.:...:|..:||..  .|.:..:|.|.|:|.
Mouse   175 --------------------------KDINRYISQKTHSRIKNMVKSI--DPGTVMILTNYIYFR 211

  Fly   176 LSWERTFNPEATYPREFRVNATKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKP 240
            ..|:..|:|:.|...||.:...|:|.:|||.:...:.......|..|.:.:|: .|::....:.|
Mouse   212 GRWQYEFDPKQTKEEEFFIEKGKTVKVPMMFQRGLYDMAYDSQLSCTILEIPY-RGNITATFVLP 275

  Fly   241 DQPDGLAALQMKLQAMNILSVARNL---TMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSK 302
            |. ..|..|:..||| :|.:..::|   .::||:|  ||.:|.|...:.....::||..||:.:.
Mouse   276 DN-GKLKLLEQGLQA-DIFAKWKSLLSKRVVDVWV--PKLRISSTYNMKKVLSRLGISKIFEENG 336

  Fly   303 SFSTLLHRNTNFRIDGVIHVVTFEFQEQGIGTPSTDVGNGSLTHTFNGVKYFLATHPFAFYIIDN 367
            .. |.:..:.:.::...:|....:..|:|:   ....|:|:.|......::.....||...|.:|
Mouse   337 DL-TRISSHRSLKVGEAVHKAELKMDEKGM---EGAAGSGAQTLPMETPRHMKLDRPFLMMIYEN 397

  Fly   368 --TSIYFAGHV 376
              .|:.|...:
Mouse   398 FMPSMVFLARI 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 81/386 (21%)
Serpina12NP_080811.1 alpha-1-antitrypsin_like 51..408 CDD:239011 82/393 (21%)
Reactive center loop. /evidence=ECO:0000250|UniProtKB:Q8IW75 364..382 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.