DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and Serpinb1a

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_079705.2 Gene:Serpinb1a / 66222 MGIID:1913472 Length:379 Species:Mus musculus


Alignment Length:383 Identity:94/383 - (24%)
Similarity:166/383 - (43%) Gaps:47/383 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGTHLSEYKPKTQKIFAM 89
            ||:..:..|....||.||...|.|::..:.:|.:...:.|:.|..|:  ..:.:...:.|.:.|.
Mouse    14 ELFQTLNESSPTGNIFFSPFSISSALAMVILGAKGSTAAQLSKTFHF--DSVEDIHSRFQSLNAE 76

  Fly    90 SVKK--APVAKSLTRFYVRQNMKMSTEYRVFMRHTEGRARNIAFAREQLDEVNTFY-SHEMGEQI 151
            ..|:  :...|...|.|..:......||....:...|         ..|..|:..: |.:..::|
Mouse    77 VSKRGASHTLKLANRLYGEKTYNFLPEYLASTQKMYG---------ADLAPVDFLHASEDARKEI 132

  Fly   152 GQVVKESWWKPNSQG-----------------LLVNAIFFNLSWERTFNPEATYPREFRVNATKS 199
            .|     |.|..::|                 :|||||:|...||..|..|.|....||::...:
Mouse   133 NQ-----WVKGQTEGKIPELLSVGVVDSMTKLVLVNAIYFKGMWEEKFMTEDTTDAPFRLSKKDT 192

  Fly   200 VMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKP----DQPDGLAALQMKLQAMNILS 260
            ..:.||::..||.||.:.:||...:.:|:..|:|.|:::.|    |:..||..::.::....:|.
Mouse   193 KTVKMMYQKKKFPFGYISDLKCKVLEMPYQGGELSMVILLPKDIEDESTGLKKIEKQITLEKLLE 257

  Fly   261 VAR--NLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVIHVV 323
            ..:  ||..:||.|.:|:|||.....|:....::|::|:|..||:..:.:..:.:..|..::|..
Mouse   258 WTKRENLEFIDVHVKLPRFKIEESYTLNSNLGRLGVQDLFSSSKADLSGMSGSRDLFISKIVHKS 322

  Fly   324 TFEFQEQGIGTPSTDVGNGSLTH-TFNGVKYFLATHPFAFYIIDN--TSIYFAGHVTS 378
            ..|..|:  ||.:.....|..|. .....:.|...|||.|:|..|  :::.|.|.|.|
Mouse   323 FVEVNEE--GTEAAAATGGIATFCMLLPEEEFTVDHPFIFFIRHNPTSNVLFLGRVCS 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 92/379 (24%)
Serpinb1aNP_079705.2 serpinB1_LEI 1..379 CDD:381028 94/383 (25%)
CARD-binding motif (CBM). /evidence=ECO:0000250|UniProtKB:P30740 351..379 11/28 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.