DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and serpina10a

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001038536.2 Gene:serpina10a / 565064 ZFINID:ZDB-GENE-041014-246 Length:391 Species:Danio rerio


Alignment Length:389 Identity:81/389 - (20%)
Similarity:149/389 - (38%) Gaps:61/389 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AQKNSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVG------------------VEEDES 62
            |.||:.....||:.|.:| |:.|:..||.....::..:..|                  |::.|.
Zfish    30 AIKNADFATRLYSKIASS-SDDNVAVSTLGATLALATLAAGAGGATQSELLQGIGVDSMVKDGEQ 93

  Fly    63 EQIRKAMHYRGTHLSEYKPKTQKIFAMSVKKAPVAKSLTRFYVRQNMKMSTEY-RVFMRHTEGRA 126
            |:|:..       |.:.:....:|.|            |..:::|::|....: ....::.....
Zfish    94 ERIQNI-------LQQLREDAAQIPA------------TGLFIKQDVKADDSFSNQVKQYYNADV 139

  Fly   127 RNIAFAREQ--LDEVNTFYSHEMGEQIGQVVKESWWKPNSQGLLVNAIFFNLSWERTFNPEATYP 189
            :|:.:|..|  ...:|.:.....||::..||:..  .|.|..:|::|.||...|.:.||...|..
Zfish   140 QNVNYANGQQAKGSINDYVRGRTGEKVRDVVENV--DPQSMAILISAAFFTGQWLQPFNATFTQE 202

  Fly   190 REFRVNATKSVMIPMMHEDSKFAFGILGNLKATAVLVPFSHGDLRMLLIKPDQPDGLAALQMKLQ 254
            ..|.||....|.:|||....|:........|...:.:|..:| :.||::.||:......:...:.
Zfish   203 DRFYVNKYNIVQVPMMLRSGKYYLAYDPTFKVGILKLPCENG-IAMLVLLPDEDVDYTYVDESMT 266

  Fly   255 AMNILSVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGV 319
            ..........|....:.:.:|:|.:.....||.:...:|:|:||..:.:. |.:..:...::..|
Zfish   267 GEVFRGWVAKLKKTKLEIQLPRFSLKQSNSLSVSLPSLGVKEIFGNTANL-TGISSSEGLKLSEV 330

  Fly   320 IHVVTFEFQEQGIGTPSTDVGNGSLTH-----TFNGVKYFLATHPFAFYIIDNTS--IYFAGHV 376
            ...|..:..|.| |:.:...||..:..     |||        .||.|.:....:  |.:.|.|
Zfish   331 EQKVAVDVDESG-GSLAEASGNLFMNPLPPRLTFN--------RPFIFVVYHEVTKCILYIGRV 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 77/378 (20%)
serpina10aNP_001038536.2 Serpin 33..388 CDD:278507 79/386 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.