DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn53F and serpinh1a

DIOPT Version :9

Sequence 1:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001103844.1 Gene:serpinh1a / 555328 ZFINID:ZDB-GENE-080219-21 Length:403 Species:Danio rerio


Alignment Length:404 Identity:87/404 - (21%)
Similarity:165/404 - (40%) Gaps:48/404 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLLLILL----------GISRYRAQKNSQLPDELYAAIVNSFSNRNIMFSTEMIRSSMLFIYVGV 57
            ||||.||          .|:...|..::.|...||..:.......||:.|..::.||:..:.:|.
Zfish     6 VLLLCLLATVSANKTLSSIATTLADNSATLAFNLYQNMAKDKDIENILISPVVVASSLGLVALGG 70

  Fly    58 EEDESEQIRKAMHYRGTHLSEYKPKTQKIFA-----MSVKKAPVAKSLT-----RFYVRQNMKMS 112
            :.:.:.|::       |.||....|.:::.:     ::....|.|:::|     |||...::...
Zfish    71 KSNTASQVK-------TVLSAASVKDEQLHSGLSELLTEVSNPKARNVTWKISNRFYGPSSVSFV 128

  Fly   113 TEY-RVFMRHTEGRARNIAF--AREQLDEVNTFYSHEMGEQIGQVVKESWWKPNSQGLLVNAIFF 174
            .:: :...:|.......|.|  .|..:..:|.:.|.....::.:|.|:.  :.....:::||:|:
Zfish   129 DDFLKSSKKHYNYDHSKINFRDKRSAVKAINDWASKSTDGKLPEVTKDV--EKTDGAMIINAMFY 191

  Fly   175 NLSWERTFNPEATYPREFRVNATKSVMIPMMHEDSKFAFGILGNL-----KATAVLVPFSHGDLR 234
            ...|...|:.:....|.|.|:.:.:|.:||||..     ||.|.|     |...:.:|.:|....
Zfish   192 KPHWNEQFHHKMVDNRGFLVHRSFTVSVPMMHRT-----GIYGFLDDTTNKLLVLEMPLAHKMSS 251

  Fly   235 MLLIKPDQPDGLAALQMKLQAMNILSVARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFK 299
            ::||.|...:.|..::..|....:.:....:....|.:.:||..:.....|.....::|:.:...
Zfish   252 LVLIMPYHVESLERVEKLLTRQQLNTWVSAMEQKAVAISLPKVSMEVSHNLQKHLAELGLTEAVD 316

  Fly   300 PSKSFSTLLHRNTNFRIDGVIHVVTFEFQEQGIGTPSTDVGNGSLTHTFNGVKYFLATHPFAFYI 364
            .:|:..:.:....:..:..|.|....|:..:| ..|.|.:..   |......|.|.|.|||.|.:
Zfish   317 KAKADLSNISGKKDLYLSNVFHASAMEWDTEG-NPPDTSIFG---TDQLKNPKLFYADHPFVFLV 377

  Fly   365 IDN--TSIYFAGHV 376
            .||  .||.|.|.:
Zfish   378 KDNKTNSILFMGRL 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 78/370 (21%)
serpinh1aNP_001103844.1 SERPIN 26..391 CDD:294093 80/382 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.